Mature • Licking 287,871 videos

• 19:34 thumb_up 73%

  Im Gonna Cumm!!! - Insane Pussy Licking Orgasm Compilation - Crazy Female Orgasms

  5 months ago

  $$ FapHousecompilationorgasm compilationorgasm

• 15:15 thumb_up 80%

  10 inches strapon lesbian fuck with a chubby mature & a teen girl Alana

  8 years ago

  Analdinkissingstockingsteen (18+)straponlesbianrussianchubby

• 18:24 thumb_up 89%

  MILF fisting MILF! Mature pussy gets orgasm

  4 years ago

  xHamsterlesbianorgasmfistinghairyczechdildoblonde

• 21:08 thumb_up 74%

  Old BBW women with fat bellys during lesbian outdoor sex at the terrace

  4 years ago

  xHamstermaturefatlesbianoutdoororgasmBBWass licking

• 05:54 thumb_up 80%

  Homemade - Granny Pleases Neighbor Boy While He Watches Football

  3 years ago

  xHamsteramateurhomemadeblowjobPOVgrannycumshotcougar

• 20:16 thumb_up 87%

  Mature Female Teacher Lena Frank seduce Big Dick Young Guy to Fuck - Mature

  4 years ago

  xHandmaturestockingsblackblowjobhairydoggingfacial

• 05:07 thumb_up 72%

  MILF sits on his face for mutual orgasm

  2 years ago

  xHamsteramateurmomhomemadefemdomorgasmfacesittingjerking

• 10:25 thumb_up 73%

  Romana, 72, Bangs a 21-Year-Old!

  5 months ago

  JizzBunkermatureteen (18+)blowjobcreampieold manlingerieshort hair

• 08:41 thumb_up 90%

  I squirt with a good cuck and cum on my pussy - Shanaa

  3 years ago

  xHamsterhandjobamateursmall cockfrenchsquirtshort hairmasturbation

• 21:27 thumb_up 61%

  Ersties - Matchmaking 4 - Bee Sets Her Boyfriend Up On Blind Date With Stunning Brunette Megan Ep 1 of 3: Porn

  6 months ago

  XXXDanamateurthreesomecouplebabecheatingblowjob

• 1:11:45 thumb_up 76%

  G L N T E E - Ginger reigh

  4 years ago

  xHandhandjobmatureblowjobvoyeurcreampiePOVgagging

• 06:30 thumb_up 82%

  Stepson fucked stepmom right after her husband

  4 years ago

  xHamsterrussiancheatinghusbandstepmombabetight

• 19:44 thumb_up 81%

  German mature housewife fucks with natural tits at swinger club

  5 years ago

  xHamsteramateurswingergermanwifeuglynaturalclub

• 15:22 thumb_up 80%

  LUSTY GRANDMAS - Naughty Pixie Is Horny For Some Fill Her Wet Pussy - Blowjob

  3 months ago

  xTitsmaturestockingsblowjobbig assgrannyfetishbig tits

• 11:10 thumb_up 80%

  Watch attractive mates video

  3 years ago

  OkXXXmaturevoyeurthreesomegrannyhairydoggingglasses

• 46:09 thumb_up 82%

  Grandmothers Having joy nine

  6 years ago

  HDSexmaturemature analanalthreesomegrannyBBWcollege

• 13:08

  What a delicious pussy lick until I cum in her mouth and I give her my milk tits

  2 weeks ago

  HogTV18amateurblowjobcum in mouthbrazilteen (18+)

• 05:19 thumb_up 89%

  Bosomed secretary in stockings gets sodomized by her boss

  4 years ago

  MilfFoxstockingsblowjobPOVgagginganaldoggingoffice

• 06:19 thumb_up 77%

  Horny MILFs swap partners in wild group sex with Mr. Creampie

  1 year ago

  XXXVoguemomhomemadecreampiebisexualthreesomeorgasmBBW

• 06:15 thumb_up 88%

  Smashing blonde MILF treats herself with young stepsons dick

  2 years ago

  XBabemomMILFblonderidingbig cock

• 15:00 thumb_up 82%

  Women Seeking Women #160 - Scene 1

  5 years ago

  PornHatmutual masturbationlesbianfacesittingass lickingstrip

• 12:30 thumb_up 81%

  Taboo sex with mature dames and boys

  4 years ago

  xHamstermommature analanalcougar

• 16:06 thumb_up 88%

  Inexperienced couple smashes MILF

  1 year ago

  HDSexass lickingFFMthreesome

• 05:48 thumb_up 84%

  Adorable teens fucking MILFs in a taboo vid

  2 years ago

  LetsPornkissingteen (18+)lesbianshort hair18caughtnatural

• 25:25 thumb_up 91%

  Big Tits Cougars Kit Mercer and Jodi West Lick Pussy

  1 week ago

  XXXDanpussymasturbationlesbianbig tits

• 55:53 thumb_up 77%

  Japanese Aunt gets fucked by Two Nephews

  4 years ago

  BeegasianjapanesesleepingMMFauntgroup

• 15:44 thumb_up 71%

  Well-proportioned Camilla Creampie and Tabitha Poisons big tits stepmom porn

  1 month ago

  PornHatlesbianchubbybig titsfacesittingpiercingnipplesass licking

• 1:10:35 thumb_up 83%

  The Sex Hustler (USA 1979, Kandi Barbour, Lisa Dwyer) - John Holmes60fps - Kandi barbour

  1 week ago

  Analdinlingerievintagefull movieclassicMILFpussy

• 12:20 thumb_up 73%

  Excited lesbians rub each others pussy till achieving orgasms

  4 years ago

  SexVidXXXlesbianczechfingering

• 06:15 thumb_up 73%

  Luke Hardy In Busty Mature Granny Sucking Big Cock After Sensual Handjob

  1 year ago

  KePornGILFgrannybritishhandjobbig cockhardcore

• 21:23 thumb_up 85%

  Teen licking cougars pussy

  1 year ago

  XXXVoguemomlesbianbig assfacesitting18ass to mouthass licking

• 15:45 thumb_up 83%

  Mavi Burbujita & Melany Two Sluts Scissor And Finger Each Other

  4 weeks ago

  PornHatorgasmlesbianfrenchhairystrapon

• 25:48 thumb_up 80%

  Sensational MILF milf NEXT DOOR - full sequence - MOM XXX

  2 weeks ago

  VideoSectionmaturemomorgasmstepmompussyneighbor

• 1:20:09 thumb_up 57%

  Fucks sleeping

  6 years ago

  BravoTubethreesomeasianjapanesedoggingsleepingnaturalFFM

• 12:09 thumb_up 76%

  Wanton coquette breathtaking xxx video

  4 years ago

  XoZillahomemadegermanthreesomemassageorgasmcheatingspy

• 16:19 thumb_up 67%

  Mellybunnyluders Ass Licked Before Pussy Creampie

  3 weeks ago

  JizzBunkergermancreampieamateurassass lickingMILF

• 04:20 thumb_up 60%

  HELLOGRANNY, Latin Matures Captured Hot and Spicy

  5 years ago

  xHamsterhomemadelatinagrannypussycompilation

• 11:59 thumb_up 88%

  Hot blonde MILF Sindy knows the importance of pleasure, and shes taking some "me time" to admire her hardbodied physique and big tits in the mirror before settling in to play with her pussy

  8 years ago

  PornHatteen (18+)lesbianass lickingmasturbationblondeold and young (18+)pussy

• 34:26 thumb_up 62%

  Her husband works far from home. Crazy for sex

  4 years ago

  Beegcreampieasianwifejapanesehusbandclothedmissionary

• 04:30 thumb_up 87%

  Horny Granny Asks for a Pussy Licking

  3 years ago

  xHamstermatureamateurstockingsgrannyorgasmhairylingerie

• 10:04 thumb_up 81%

  French girl, anilingus, cum drink

  3 months ago

  XXXVogueamateurfrenchcreampieanalass to mouthass lickingdirty talk

• 26:10 thumb_up 73%

  Kaede Tsutsumi - Trapped with a horny older woman - Part 2

  1 year ago

  XXXVoguehandjobmassageasianjapaneseauntjapanese momfingering

• 20:06 thumb_up 64%

  Grandma & Grandpa Celebrate Wild Sex Party

  1 year ago

  xHamstermaturemompartycouplegrannychubbyorgasm

• 06:00 thumb_up 77%

  Female doc leaves patient with huge balls to fuck her hard

  9 years ago

  XBabeblowjobdoctornursefacesittingfacialglassescumshot

• 15:05 thumb_up 70%

  Unreleased amateur porn with 90s housewives 2

  3 years ago

  JizzBunkerpissingcastingitalianwifehairyclitvintage

• 25:44 thumb_up 82%

  Happy Camping 2

  4 years ago

  xHamsteramateursquirtbig asscoupleoutdoornipplesass licking

• 07:51 thumb_up 91%

  Clit Licking Practice # 5 - the Art of Lesbian Licking

  2 years ago

  xHamsterlesbianorgasmfacesittingclitnatural69big clit

• 26:37 thumb_up 88%

  Serbian seductress Nia Black grinds her wet slit against her lover in fiery scissoring

  3 months ago

  YesVidsserbianlesbianteen (18+)black

• 1:23:22 thumb_up 70%

  The family friend! (Full Movie)

  2 years ago

  SunPornolesbianoutdoorlingeriefull moviebrunettekissing

• 24:52 thumb_up 95%

  Blonde Granny and Mature Redhead Milf Lick Each Others Pussies While Fingering and Masturbating

  4 days ago

  JizzBunkerlesbiangrannymature

• 10:34 thumb_up 82%

  Watch fascinating GFs sex

  3 years ago

  PornHatgermangrannydoggingfacialclitglassesriding

• 10:43 thumb_up 81%

  Big ass scene with fine-looking fancy bit from Mature NL

  3 months ago

  PornHatmomkissingfatlesbianthreesomegrannyfacesitting

• 22:53 thumb_up 74%

  Hot wife gets satisfied by her neighbor

  2 years ago

  xHamsterkissinggermanwifeorgasmclitswallowbig cock

• 05:07 thumb_up 64%

  Extremely hot and horny wife with her dirty secrets in the hotel room

  2 years ago

  xHamsterhomemadecouplefetishwifeass lickingasshotel

• 08:00 thumb_up 80%

  Bruno Baxter - Jaylee - Erik 52 Year Old Stepmom Jaylee Caught Her Stepson And His Best Friend Measuring Cocks And Wants Both

  2 weeks ago

  Fuxxxcaughthardcorecum in mouthstepmommatureheels

• 15:09 thumb_up 83%

  53-Year-Old Jane Celebrates Her Birthday With a Dripping Creampie

  1 week ago

  PornHatgrannybig titsmatureGILFbritishass licking

• 04:23 thumb_up 80%

  Kathy Deep Blue

  6 months ago

  SomePornhandjobmaturebig assoutdoorpoolarmpitbikini

• 05:01 thumb_up 84%

  Cheating red haired wife Lauren Phillips gets nailed in spoon pose

  8 years ago

  XCafehandjobwifecheatingass lickingridingwhoremissionary

• 07:51 thumb_up 85%

  Gorgeous Mom with pale skin squirts for the first time in a sensual massage room

  3 years ago

  HogTVmomsquirtmassageshavingsmall titsfirst timebrunette

• 06:54 thumb_up 81%

  Young lad fucks babe and her old stepmom in dirty home FFM

  3 years ago

  HellPornomatureamateurmomblowjobthreesomestepmomriding

• 38:39 thumb_up 55%

  Amateur swinger drunk party in the saune. 2 hot wives get shared in orgy.

  8 years ago

  Analdinstockingsfrenchswingerpartyrussianhairydrunk

• 22:52 thumb_up 84%

  A hot girl with red hair wears sexy lingerie and provocative clothes to meet a friend and get her pussy and ass fucked

  3 years ago

  xHamsteramateurmomhomemadepantyhoseitaliananalbig ass

• 12:04 thumb_up 81%

  Aroused old sluts fucked by the same guy in a loud trio

  2 years ago

  LetsPornkissingthreesomedoggingtattooofficecaughtriding

• 15:10 thumb_up 88%

  The Prettiest Girl At Closing Time

  4 years ago

  xHamstermaturecreampiemature analanalgrannyass to mouthass licking

• 15:00 thumb_up 77%

  Rich Girl And Her Maid 2 - Milfs Lick Teenagers

  4 years ago

  Analdinkissinglesbianmaidfacesittingspankingass lickingmasturbation

• 10:25 thumb_up 85%

  Mature NL - bubble butt smut

  3 years ago

  OkXXXmaturelesbiandildobritishmasturbationclose upheels

• 07:10 thumb_up 83%

  Mother and stepdaughter enjoying a wet afternoon outside in the garden

  1 year ago

  xHamsterpissingmaturemomteen (18+)lesbiangrannychubby

• 05:29 thumb_up 87%

  Seductive home play between the young slut and her step mom

  5 years ago

  HellPornomomlesbianuglylesbian seductionslutmature

• 10:45 thumb_up 87%

  Watch erotic Vicky Loves trailer

  2 years ago

  PornHatlesbiangrannybritish18ass lickingmasturbationerotic

• 34:51 thumb_up 83%

  Women With Experience

  3 years ago

  xHamsterthreesomecougarcum in mouthbig ass

• 13:51 thumb_up 80%

  Cuckquean Cleanup - Licking My Husband's Creampie Out Of My MILF Friend While He Fucks And Fills Me

  1 year ago

  xHamsteramateurmomcreampiethreesomeorgasmBBWcuckold

• 10:06 thumb_up 84%

  Flattering miss - hd dirt - Mature NL

  3 years ago

  OkXXXmaturestraponlesbiangrannyfetishhairyass licking

• 19:37 thumb_up 90%

  Better With Age, Like Fine Wine

  5 years ago

  xHamsteramateurstraponlesbiandildoass licking69blonde

• 33:35 thumb_up 92%

  Mugurs pussy licking xxx

  2 months ago

  PornHatmaturefeetstockingsblowjobcreampiewifecheating

• 04:59 thumb_up 76%

  Japanese mom Beni Itou gets her hairy snatch licked and fucked hard

  12 years ago

  AnyPornmomasianhairyjapanese momjapanese

• 15:48 thumb_up 84%

  Japanese Schoolgirl Eats Out Her 50 yr old Stepmother’s gash

  5 months ago

  VideoSectionmomasianjapaneseshort hairnipplesstepmomjapanese mom

• 12:55 thumb_up 91%

  Ebony Teenages Very First Lezzie Plumb With Expert COUGAR - GirlfriendsFilms

  5 years ago

  PornGemlesbianorgasmkissinginterracial

• 07:11 thumb_up 79%

  The penis is all in my pussy juice and I suck it and lick it clean.He fucks me and cums inside me.

  2 years ago

  xHamstermomcreampiepolishhairynipplesdirty talkpenis

• 13:44 thumb_up 76%

  I'M GONNA CUMMM - HER SOUL LEFT HER BODY - EXPLOSIVE ORGASM COMPILATION

  2 years ago

  xHamstercreampieorgasmczechcreampie compilationcompilationorgasm compilationmissionary

• 18:18 thumb_up 61%

  The Next Door Neighbor: "I'll Suck You Off If You Go Down On Me Too..." - Part.3

  3 years ago

  xHamsterhandjobmaturebeautycreampiemassageasianwife

• 12:54 thumb_up 88%

  Fitness-Loving Granny Lets Her Spotter Work Out Her Ass

  4 years ago

  xHamstergrannyfingeringhardcoregranny analanalmature anal

• 12:00 thumb_up 88%

  Horny grannies threesome emotional xxx video

  1 year ago

  Analdinblackblowjobthreesomegrannyass lickingbabeass

• 10:52 thumb_up 87%

  Massive Clit MILF Licked By Teen - Mommy And Fiona(4K) - Big tits

  2 years ago

  xTitsamateurmomlesbianbig assorgasmclitass licking

• 10:48 thumb_up 86%

  Sultry donas step fantasy video

  2 years ago

  PornHatmomkissinglesbianhairyass lickingstepmomblonde

• 08:00 thumb_up 71%

  Korean Fun: Let your sexy stepsister shower and touch you

  1 year ago

  HDTubekoreanshower

• 44:22 thumb_up 82%

  Two Cougars Seduce A Young Hottie

  1 year ago

  XXXDanlingeriecougarlesbianthreesomemasturbationseduced

• 10:15 thumb_up 85%

  Flawless moves to plow old Couple

  1 year ago

  MatureClubpick uplingeriethreesomecouplecougarblowjob

• 19:50 thumb_up 78%

  German mature woman secretary seduced younger guy in office

  6 years ago

  xHamstermatureblowjobgermanwifefunnyofficesecretary

• 54:40 thumb_up 73%

  Pervert of panties is lucky with woman: Big Ass, Blowjob Babe Porn

  11 months ago

  XXXDanjapaneseasianpantiesass licking

• 28:43 thumb_up 65%

  Horny MILF Passionate Hardcore Sex Session – Homemade Sex Tape

  3 weeks ago

  PornHatmaturehomemadestockingsold manwifecrossdresser

• 05:53 thumb_up 85%

  MILF bitch Arwen licks sweet pussy of her stepdaughter Serina Gomez

  3 years ago

  MegaTubekissingteen (18+)lesbianfacesittingshort hairass lickingclassic

• 18:22 thumb_up 77%

  I help my stepsister clean the dining room and we end up fucking on top of him

  3 years ago

  xHamsterindianlesbianbisexualdildoass lickingmasturbationcum in mouth

• 15:46 thumb_up 87%

  Double blowjob movie with sex hungry Mugur and Nikki Nuttz from Mature NL

  1 year ago

  PornHatmommature analanalsquirtorgasmhairyfacesitting

• 05:59 thumb_up 83%

  Juicing tour while driving! Caught fucking!!!

  3 years ago

  xHamsterhandjobamateurblowjobgermanMILFhairycar

• 20:00 thumb_up 87%

  ???@ & ???? - ??????? & ?????? ? - Interracial

  1 month ago

  xTitsblondelesbianmasturbationebony

• 21:15 thumb_up 88%

  Blonde Wife Takes Big Cock Creampie for Husband on Phone

  2 weeks ago

  XXXDanwifecuckoldinterracialMILFbig cockcreampie

• 10:13 thumb_up 88%

  Two Very Hairy Mature Lesbians Diana & Barbara Satisfy Each Others Sexual Needs

  1 year ago

  xHamstercreampielesbianrussianskinnyfingeringhairy

• 04:56 thumb_up 71%

  Raven and Monicas steamy encounter unveils their plump naturals

  2 weeks ago

  HellPornohomemadelesbianamateur

• 10:33 thumb_up 76%

  ONE NASTY old Granny

  5 years ago

  xHamsteramateurblowjobcreampiebisexualgrannybondageass licking

• 13:08 thumb_up 84%

  FAMILYxxx - married scene

  3 years ago

  OkXXXwifecheatingstepmomdeepthroatrealityfantasy

• 15:00 thumb_up 89%

  Moms Bang Teens in Quality Time Threesome Action - 2 Blondes Cherie DeVille, Dakota Skye versus Chad Alva

  9 months ago

  xTitsmomlesbiantattooass lickingFFMrealityskinny

• 07:59 thumb_up 78%

  Daddys Luder In Lick Me Before You Thrust In! Fuck, No Needim Already Wet, Itll Slide In Effortlessly!

  2 weeks ago

  Fuxxxgermanmom

• 15:27 thumb_up 59%

  Greatest REMEDY FOR INSOMNIA WITH ADAMANDEVE AND LUPO

  1 year ago

  HDSexhandjobmatureblackcoupleorgasmlatinanipples

• 20:54 thumb_up 78%

  Hotwife rides fat guy till orgasm - Big dick

  4 years ago

  xTitsamateurmomfatnurseorgasmbig titsspanking

• 12:38 thumb_up 88%

  Untitled

  5 months ago

  JizzBunkerteen (18+)lesbianfetishlingerieass lickingmasturbationbrunette

• 32:43 thumb_up 20%

  Blonde MILFs Ass-Licking Ass-To-Mouth DP Creampie

  1 week ago

  XXXDananaldouble analass to mouthass lickingdouble penetration

• 07:50 thumb_up 86%

  Nasty granny Kathleen Violet pleases her aged neighbor

  10 years ago

  XCafegrannyneighbor

• 32:24 thumb_up 61%

  Girlies homemade mature wife scene

  3 months ago

  PornHatmatureamateurhomemadewifecheatingdildotied

• 09:59 thumb_up 83%

  Watch these two horny lesbians toying ass

  2 months ago

  SomePornmaturekissinglesbianmature analcoupleass lickingtoys

• 10:46 thumb_up 86%

  Cunning Nina Heels - lesbians porn - Mature NL

  2 months ago

  PornHatlesbianfacesittinglesbian seductionclose upheelsGILF

• 15:43 thumb_up 64%

  Celeste Big Tits – Girls Eat Pussy Until They Cum

  3 weeks ago

  PornHatmaturefeetfemdomstraponsquirthairyglasses

• 15:43 thumb_up 68%

  Rockhardo Black Big Ass – Black And White Passionate Rough Sex

  3 weeks ago

  PornHatmatureblackfatblowjobchubbyinterracialMILF

• 10:38 thumb_up 81%

  Pussy Licking Orgasm Eating Out My Hot Step Sister Before Working On Our Tans - Kat Marie - Taboo Heat - Cory Chase

  4 months ago

  TheyAreHugeamateurblowjoblesbianorgasmhairylactatingass licking

• 10:52 thumb_up 75%

  Perverted stepfather sticks his fingers under my short skirt masturbating me then he fucks me dirty doggy style.

  3 years ago

  xHamsterindianPOVanallingeriedogginghusbandass licking

• 04:57 thumb_up 86%

  Energized blonde mom reaches the orgasm after a long pause

  4 years ago

  XBabemomorgasmblondeshaving

• 04:58 thumb_up 77%

  Dude fucks his sexy aunt and comes on her sexy face

  4 years ago

  HellPornoamateurmomblowjobgrannydoggingcumshotaunt

• 10:40 thumb_up 84%

  SHAME4K. Student enters bathroom and meets stepmoms friend wet and naked

  3 years ago

  xHamstermaturerussianstudent18stepmomnaturalblonde

• 12:30 thumb_up 84%

  Husband Licks Wifes Pussy Until She Gets Really Intense Orgasm And Then He Fucks Her Passionately

  3 years ago

  TheyAreHugeteen (18+)analcouplewifeteen anal (18+)orgasmdogging

• 10:29 thumb_up 76%

  Cock Sucking Husbands

  5 years ago

  xHamstermombisexualcouplecuckoldhusband18ass licking

• 07:00 thumb_up 87%

  MILFs worship one anothers wet pussies in classroom seduction

  2 years ago

  XBabelesbianoffice69lesbian seductionwetshavingpussy

Categories

Other free porn sites