Mature • Licking 66,360 videos

• 38:57 thumb_up 81%

  Religious Stepmom Kit Mercer Invites Stepdaughter Allie Nicole For A Midnight Obedience Lesson

  4 years ago

  xHamsterteen (18+)POVbig assthreesomebig tits18ass licking

• 16:19 thumb_up 86%

  Leather couch living room talk

  2 weeks ago

  PornHatlesbianhairyass licking69leatherbabeass

• 15:43 thumb_up 82%

  Sensual Natas student porn

  6 months ago

  PornHatmatureblowjobbig assgrannystudentdoggingshort hair

• 16:46 thumb_up 69%

  Horny MILF Raw Bedroom Fuck Until She Drips – Rimjob Finale

  3 weeks ago

  PornHatmatureamateurstockingsitalianbig assgrannyhairy

• 17:44 thumb_up 85%

  Lovely Chloe Amour and Chloe Lamours pussy licking sex

  5 months ago

  PornHatebonykissinglesbianthreesomeorgasmczechbig tits

• 33:55 thumb_up 52%

  Old & Young Lesbian Group Sex Party Goes Wild

  1 week ago

  $$ FapHousematurelesbianold and young (18+)assorgypartykissing

• 15:03 thumb_up 82%

  German threesome

  2 years ago

  NuVidamateurPOVgermanthreesomebig titsblondetitjob

• 15:52 thumb_up 67%

  Housewife Big Titty Friend - Lesbian Porn

  7 years ago

  XoZillamomfatlesbiangrannymassagefetishchubby

• 15:41 thumb_up 82%

  Lovely GF - cougar dirt - Mature NL

  2 months ago

  PornHatmaturestockingsitalianblowjobmature analanalbig ass

• 52:07 thumb_up 87%

  I FUCK LIL TIMY AFTER SPYING ON HIM SEVERAL TIMES WATCHING ALL THE HOT THINGS HE WAS DOING WITH EMMA

  3 months ago

  SunPornomaturemomblowjobMILFlatinaspycumshot

• 18:02 thumb_up 90%

  Rolf and Emilia B Russian Mature Blowjob

  1 week ago

  XXXDanlingerieblowjobmatureold and young (18+)

• 15:43 thumb_up 85%

  Mature NL - petite sex

  7 months ago

  PornHatkissinglesbianbig assgrannyfetishhairy18

• 22:21 thumb_up 66%

  Anna Berger Rims Ass Before Facial

  2 days ago

  XXXDanfacialgrannymaturebig cockblowjob

• 38:47 thumb_up 83%

  Lesbian mature lady wants teen pussy

  5 years ago

  xHandmatureamateurmomkissingteen (18+)lesbiannatural

• 15:11 thumb_up 75%

  Blonde Milf Landlady Fucks Renters

  3 months ago

  XXXDanblowjobgermanMILFlingeriedoggingblondeskinny

• 28:53 thumb_up 75%

  Japanese Mature Office lady with humungous Ass seduce Shy Boy to Creamie Fuck at Work

  2 months ago

  HDSexmomcreampieanalasianhairyjapaneseoffice

• 15:25 thumb_up 83%

  Blonde Milf Mom and Stepsons Creampie Deep-Throat

  2 weeks ago

  XXXDanhandjobmomlingeriestepmomfantasy

• 16:14 thumb_up 73%

  Son, you think you can work in porn: Big Tits, Blowjob Milf Porn

  10 months ago

  XXXDanhandjobmaturecreampiebig titsdoggingbig cockmissionary

• 22:14 thumb_up 84%

  Redhead MILF has sex after a long abstinence

  3 years ago

  xHamsteramateurmomkissingblowjobrussianMILFredhead

• 1:01:30 thumb_up 87%

  Prurient Penny Barber and Reese Robbins at hardcore porn

  4 months ago

  PornHatmomblowjobcreampiesquirtthreesomestepmomfull movie

• 29:45 thumb_up 79%

  Horny Guy Licked His Chubby Wife

  4 years ago

  VXXXhandjobmatureamateurstockingsPOVmature analanal

• 23:38 thumb_up 80%

  Guy fucked girlfriends grandmother

  6 years ago

  BravoTubehandjobmatureamateurhomemadeblowjobcouplebig tits

• 15:40 thumb_up 77%

  Exciting Regina Moonshine at hd clip

  1 year ago

  PornHatkissinglesbiangrannyshort hair18masturbation69

• 18:48 thumb_up 79%

  I Love to fuck your Grandma

  4 years ago

  xHamsteranalgrannyorgasmvintagepussyhardcoregranny anal

• 35:24 thumb_up 78%

  Bidie-ins big tits scene

  3 years ago

  OkXXXamateurcreampiebig assgrannychubbyhairybig tits

• 15:16 thumb_up 79%

  Is Your Son Home, Mrs. Raines?

  3 years ago

  xHamstermaturemombig assinterracialbig titsass lickingcumshot

• 21:09 thumb_up 82%

  Big natural Tits chinese Mature give cherry nubile First Time Strapon Anal Fuck at Uncensored Lesbian Sex in Japan

  2 months ago

  MatureClubkissingstraponlesbianmature analcoupleasianorgasm

• 15:46 thumb_up 81%

  Mature NL - old young lesbians video

  1 month ago

  PornHatlesbianfacesittingnipplesstepmom69lesbian seductionshaving

• 15:44 thumb_up 79%

  A big hard cock for the granny bitch in love

  4 years ago

  xHamsteramateuranalgrannybig cockclubhousewifepussy

• 19:09 thumb_up 80%

  German grandmother gets horny at massage and fucks

  6 years ago

  xHamstermatureamateurmomgermanmature analanalgranny

• 49:49 thumb_up 64%

  Erotic Couple Passionate Energetic Full Sex Video Includes Anal

  3 weeks ago

  HogTVamateurfeethomemadecreampieanalorgasmerotic

• 24:52 thumb_up 94%

  Blonde Granny and Mature Redhead Milf Lick Each Others Pussies While Fingering and Masturbating

  3 days ago

  JizzBunkerlesbiangrannymature

• 18:58 thumb_up 79%

  Big Tits Milf Nurse Performs Every Sperm Donation Task Herself

  2 months ago

  XXXDanblowjobnurserussianbig titsspermbrunette

• 1:04:25 thumb_up 59%

  Sweet vintage porn compilation featuring the hottest pornstars

  5 years ago

  OkXXXhandjobkissingass lickingcompilationvintagehandjob compilationpussy

• 16:38 thumb_up 74%

  Professor Mellanie Monroe Treats Her Student With Some Wet MILF Pussy

  1 month ago

  JizzBunkermaturemature analanalsquirtstudentMILFbig tits

• 24:40 thumb_up 54%

  Amateur blonde and brunette lesbians on webcam

  2 years ago

  VipTubelesbianMILFvintagehairywebcam

• 30:54 thumb_up 79%

  Sex therapist over 60 gives young man help with jerking off

  1 year ago

  xHamsterhandjobmomold mangermangrannychubbyhairy

• 29:12 thumb_up 80%

  Mature NL featuring Sam Bournes compilation trailer

  1 year ago

  PornHatgrannyhairybig titsdoggingshort haircompilationcougar

• 18:22 thumb_up 72%

  Mature Blonde Initiates First-Time Ass-Licking

  1 week ago

  JizzBunkermaturelesbianorgasmass lickinghungarian

• 1:01:39 thumb_up 75%

  DEVILS FILM - 1 HOUR Of NUDIST NEIGHBORS COMPILATION! MILF, Huge Tits, Public, And MORE!

  3 weeks ago

  SomePornpublicblowjobdoggingnudistcompilationrealitypussy

• 1:02:52 thumb_up 85%

  Cuckolded husband offers gangbang to his wife with several men fucking her and him crazy watching

  3 years ago

  xHamsteramateurasiancheatingjapaneseflashingcuckoldhusband

• 31:18 thumb_up 92%

  Finger Licking Good First Time Lesbian Seduction

  3 weeks ago

  Sexulesbianlesbian seductionMILF69teen (18+)

• 32:28 thumb_up 60%

  I recommend everyone to bound and fuck your stepmother! I do it everyday!

  3 years ago

  xHamstermatureamateurmomhomemadeblowjobbondagedogging

• 43:31 thumb_up 85%

  Japanese Mom and Wife in sexless marriage SEDUCED by their therapist - Erotic Spice

  8 months ago

  SexPlexlesbianasianwifecheatingjapaneseeroticseduced

• 15:50 thumb_up 91%

  His Choice Of Butts To Fuck

  5 years ago

  xHamsteramateurmomanalbig assthreesomehairyredhead

• 21:05 thumb_up 83%

  Under the masks of Paris

  5 months ago

  MatureClubblowjobswingerbig titsredheadass to mouthass lickinggangbang

• 17:21 thumb_up 83%

  Stepdaughter's first time. Kinky Family Games!

  3 years ago

  xHamstermatureamateurhomemadeblowjobgermanthreesomeMILF

• 24:27 thumb_up 93%

  Lesbian Fun, Fisting

  2 weeks ago

  Sexupissinglesbianold manfistinghairy18ass licking

• 18:55 thumb_up 80%

  Stepson Is Leaving Home, But Stepmom Gives Her Slit To Stay

  3 years ago

  HomemadeXXXmatureindianhomemadefatblowjobgermanmature anal

• 17:11 thumb_up 89%

  Busty woman lets a skater enjoy her body

  13 years ago

  Beegmomtalldoggingglasses

• 19:37 thumb_up 87%

  UK Pure Blonde Filth Stepsister Taboo Love #4 Full Scene

  4 years ago

  xHamsterhomemadesmall cockbritishnaturalclose upsmall titsnerdy

• 39:18 thumb_up 64%

  After school punishment

  7 years ago

  Beegpissinglesbianthreesomeinsertionheelsstepmom

• 21:08 thumb_up 74%

  Old BBW women with fat bellys during lesbian outdoor sex at the terrace

  4 years ago

  xHamstermaturefatlesbianoutdoororgasmBBWass licking

• 15:22 thumb_up 80%

  LUSTY GRANDMAS - Naughty Pixie Is Horny For Some Fill Her Wet Pussy - Blowjob

  3 months ago

  xTitsmaturestockingsblowjobbig assgrannyfetishbig tits

• 18:24 thumb_up 89%

  MILF fisting MILF! Mature pussy gets orgasm

  4 years ago

  xHamsterlesbianorgasmfistinghairyczechdildoblonde

• 21:27 thumb_up 61%

  Ersties - Matchmaking 4 - Bee Sets Her Boyfriend Up On Blind Date With Stunning Brunette Megan Ep 1 of 3: Porn

  6 months ago

  XXXDanamateurthreesomecouplebabecheatingblowjob

• 21:33 thumb_up 83%

  Serving stepMommyDommes vag

  1 year ago

  VideoSectionmaturemomfeetstockingsfemdomlesbiancouple

• 16:06 thumb_up 88%

  Inexperienced couple smashes MILF

  1 year ago

  HDSexass lickingFFMthreesome

• 19:34 thumb_up 73%

  Im Gonna Cumm!!! - Insane Pussy Licking Orgasm Compilation - Crazy Female Orgasms

  5 months ago

  $$ FapHousecompilationorgasm compilationorgasm

• 15:15 thumb_up 80%

  10 inches strapon lesbian fuck with a chubby mature & a teen girl Alana

  8 years ago

  Analdinkissingstockingsteen (18+)straponlesbianrussianchubby

• 1:20:09 thumb_up 57%

  Fucks sleeping

  6 years ago

  BravoTubethreesomeasianjapanesedoggingsleepingnaturalFFM

• 19:44 thumb_up 81%

  German mature housewife fucks with natural tits at swinger club

  5 years ago

  xHamsteramateurswingergermanwifeuglynaturalclub

• 1:11:45 thumb_up 76%

  G L N T E E - Ginger reigh

  4 years ago

  xHandhandjobmatureblowjobvoyeurcreampiePOVgagging

• 15:45 thumb_up 86%

  Mavi Burbujita & Melany Two Sluts Scissor And Finger Each Other

  3 weeks ago

  PornHatorgasmlesbianfrenchhairystrapon

• 20:16 thumb_up 87%

  Mature Female Teacher Lena Frank seduce Big Dick Young Guy to Fuck - Mature

  4 years ago

  xHandmaturestockingsblackblowjobhairydoggingfacial

• 55:53 thumb_up 77%

  Japanese Aunt gets fucked by Two Nephews

  4 years ago

  BeegasianjapanesesleepingMMFauntgroup

• 25:25 thumb_up 93%

  Big Tits Cougars Kit Mercer and Jodi West Lick Pussy

  1 week ago

  XXXDanpussymasturbationlesbianbig tits

• 1:23:22 thumb_up 70%

  The family friend! (Full Movie)

  2 years ago

  SunPornolesbianoutdoorlingeriefull moviebrunettekissing

• 34:26 thumb_up 62%

  Her husband works far from home. Crazy for sex

  4 years ago

  Beegcreampieasianwifejapanesehusbandclothedmissionary

• 21:23 thumb_up 85%

  Teen licking cougars pussy

  1 year ago

  XXXVoguemomlesbianbig assfacesitting18ass to mouthass licking

• 1:10:35 thumb_up 81%

  The Sex Hustler (USA 1979, Kandi Barbour, Lisa Dwyer) - John Holmes60fps - Kandi barbour

  1 week ago

  Analdinlingerievintagefull movieclassicMILFpussy

• 15:44 thumb_up 70%

  Well-proportioned Camilla Creampie and Tabitha Poisons big tits stepmom porn

  1 month ago

  PornHatlesbianchubbybig titsfacesittingpiercingnipplesass licking

• 20:06 thumb_up 64%

  Grandma & Grandpa Celebrate Wild Sex Party

  1 year ago

  xHamstermaturemompartycouplegrannychubbyorgasm

• 46:09 thumb_up 82%

  Grandmothers Having joy nine

  6 years ago

  HDSexmaturemature analanalthreesomegrannyBBWcollege

• 26:10 thumb_up 73%

  Kaede Tsutsumi - Trapped with a horny older woman - Part 2

  1 year ago

  XXXVoguehandjobmassageasianjapaneseauntjapanese momfingering

• 25:48 thumb_up 81%

  Sensational MILF milf NEXT DOOR - full sequence - MOM XXX

  2 weeks ago

  VideoSectionmaturemomorgasmstepmompussyneighbor

• 15:05 thumb_up 70%

  Unreleased amateur porn with 90s housewives 2

  3 years ago

  JizzBunkerpissingcastingitalianwifehairyclitvintage

• 22:53 thumb_up 74%

  Hot wife gets satisfied by her neighbor

  2 years ago

  xHamsterkissinggermanwifeorgasmclitswallowbig cock

• 25:44 thumb_up 82%

  Happy Camping 2

  4 years ago

  xHamsteramateursquirtbig asscoupleoutdoornipplesass licking

• 26:37 thumb_up 89%

  Serbian seductress Nia Black grinds her wet slit against her lover in fiery scissoring

  3 months ago

  YesVidsserbianlesbianteen (18+)black

• 33:35 thumb_up 92%

  Mugurs pussy licking xxx

  2 months ago

  PornHatmaturefeetstockingsblowjobcreampiewifecheating

• 15:10 thumb_up 88%

  The Prettiest Girl At Closing Time

  4 years ago

  xHamstermaturecreampiemature analanalgrannyass to mouthass licking

• 34:51 thumb_up 83%

  Women With Experience

  3 years ago

  xHamsterthreesomecougarcum in mouthbig ass

• 16:19 thumb_up 67%

  Mellybunnyluders Ass Licked Before Pussy Creampie

  2 weeks ago

  JizzBunkergermancreampieamateurassass lickingMILF

• 38:39 thumb_up 55%

  Amateur swinger drunk party in the saune. 2 hot wives get shared in orgy.

  8 years ago

  Analdinstockingsfrenchswingerpartyrussianhairydrunk

• 18:18 thumb_up 61%

  The Next Door Neighbor: "I'll Suck You Off If You Go Down On Me Too..." - Part.3

  3 years ago

  xHamsterhandjobmaturebeautycreampiemassageasianwife

• 44:22 thumb_up 82%

  Two Cougars Seduce A Young Hottie

  1 year ago

  XXXDanlingeriecougarlesbianthreesomemasturbationseduced

• 28:43 thumb_up 63%

  Horny MILF Passionate Hardcore Sex Session – Homemade Sex Tape

  3 weeks ago

  PornHatmaturehomemadestockingsold manwifecrossdresser

• 22:52 thumb_up 84%

  A hot girl with red hair wears sexy lingerie and provocative clothes to meet a friend and get her pussy and ass fucked

  3 years ago

  xHamsteramateurmomhomemadepantyhoseitaliananalbig ass

• 19:37 thumb_up 90%

  Better With Age, Like Fine Wine

  5 years ago

  xHamsteramateurstraponlesbiandildoass licking69blonde

• 19:50 thumb_up 78%

  German mature woman secretary seduced younger guy in office

  6 years ago

  xHamstermatureblowjobgermanwifefunnyofficesecretary

• 32:24 thumb_up 60%

  Girlies homemade mature wife scene

  3 months ago

  PornHatmatureamateurhomemadewifecheatingdildotied

• 15:48 thumb_up 84%

  Japanese Schoolgirl Eats Out Her 50 yr old Stepmother’s gash

  5 months ago

  VideoSectionmomasianjapaneseshort hairnipplesstepmomjapanese mom

• 15:09 thumb_up 89%

  53-Year-Old Jane Celebrates Her Birthday With a Dripping Creampie

  1 week ago

  PornHatgrannybig titsmatureGILFbritishass licking

• 54:40 thumb_up 74%

  Pervert of panties is lucky with woman: Big Ass, Blowjob Babe Porn

  11 months ago

  XXXDanjapaneseasianpantiesass licking

• 20:52 thumb_up 75%

  Horny grannies share one young dick

  3 years ago

  HomemadeXXXhomemadesmall cockcreampieswingergermanthreesomegranny

• 29:03 thumb_up 94%

  Blonde granny eleanor gets her pussy licked & fucked by her toy boy

  4 months ago

  TXXXmaturegrannybritishpussy

• 15:46 thumb_up 87%

  Double blowjob movie with sex hungry Mugur and Nikki Nuttz from Mature NL

  1 year ago

  PornHatmommature analanalsquirtorgasmhairyfacesitting

• 18:22 thumb_up 77%

  I help my stepsister clean the dining room and we end up fucking on top of him

  3 years ago

  xHamsterindianlesbianbisexualdildoass lickingmasturbationcum in mouth

• 20:54 thumb_up 78%

  Hotwife rides fat guy till orgasm - Big dick

  4 years ago

  xTitsamateurmomfatnurseorgasmbig titsspanking

• 15:43 thumb_up 61%

  Celeste Big Tits – Girls Eat Pussy Until They Cum

  3 weeks ago

  PornHatmaturefeetfemdomstraponsquirthairyglasses

• 20:00 thumb_up 87%

  ???@ & ???? - ??????? & ?????? ? - Interracial

  1 month ago

  xTitsblondelesbianmasturbationebony

• 15:27 thumb_up 59%

  Greatest REMEDY FOR INSOMNIA WITH ADAMANDEVE AND LUPO

  1 year ago

  HDSexhandjobmatureblackcoupleorgasmlatinanipples

• 21:15 thumb_up 86%

  Blonde Wife Takes Big Cock Creampie for Husband on Phone

  2 weeks ago

  XXXDanwifecuckoldinterracialMILFbig cockcreampie

• 1:23:07 thumb_up 77%

  Short haired matures showing off their amazing cockhandling skills

  7 years ago

  Analdinmaturethreesomerussianshort haircompilationgangbang69

• 40:20 thumb_up 89%

  Mother Lover Society

  3 years ago

  JizzBunkerlesbianhardcore

• 16:08 thumb_up 67%

  Romantic bathroom Sex �� Passionate Couple Sensual Foreplay kissing Blowjob Standing Making enjoy Cum

  11 months ago

  MatureClubhandjobmatureamateurkissinghomemadeblowjobcouple

• 48:50 thumb_up 85%

  French granny anal

  6 years ago

  BravoTubestockingsfrenchcouplegrannyredheadglassesswallow

• 15:42 thumb_up 86%

  Lusty Jenys anal sex

  3 months ago

  PornHatmaturemomfrenchblowjobmature analanalbig ass

• 15:43 thumb_up 68%

  Rockhardo Black Big Ass – Black And White Passionate Rough Sex

  3 weeks ago

  PornHatmatureblackfatblowjobchubbyinterracialMILF

• 16:34 thumb_up 57%

  Untitled

  4 days ago

  XXXDanpissingitalianass licking

• 16:04 thumb_up 84%

  Young Lesbian Brunette Eats Bald Cunt Of Older Chubby Dyke

  8 years ago

  Analdinsmall cockfatlesbianrussianchubbyhairylingerie

• 20:50 thumb_up 80%

  Lesbian Couple Anal Fuck in Hotel - Sovereign syre does ass to mouth with anal toy

  4 years ago

  xTitsmomlesbianmature analanalcouplelatinaass to mouth

• 26:01 thumb_up 63%

  HotMILFsFuck - Ember - Anal

  3 years ago

  IcePornmaturemature analanalbig tits

• 3:38:46 thumb_up 70%

  Gangbang for Japanese wife

  6 years ago

  BravoTubeamateurblowjobasianjapanesecuckoldass lickinggangbang

• 1:07:20 thumb_up 72%

  Sexy European Teen Sandra Crosses Her B - Creampie

  4 years ago

  xHandhandjobteen (18+)voyeurcreampiemature analgaggingbig ass

• 22:02 thumb_up 75%

  Brunette slut makes lesbian love with grandmother

  6 years ago

  XoZillamomlesbiangrannydildoold and young (18+)pussybrunette

• 16:11 thumb_up 87%

  Stacked mature housewife turns her husband into a cuckold

  6 years ago

  PornLibcuckoldhousewifecreampiehusband

• 24:08 thumb_up 77%

  Premature Cumshot Compilation

  8 years ago

  Analdinteen (18+)creampiecreampie compilationcompilationcumshotteachercumshot compilation

• 33:09 thumb_up 77%

  Mature Ilsa Gets Her Hairy Pussy Licked by Young Babe Taissia Shanti

  5 months ago

  $$ FapHouselesbianbig asscouplehairyass lickingbabeass

Categories

Other free porn sites