Mature • Wife Masturbating 37,121 videos

• 06:01 thumb_up 78%

  I Want You to Fuck My Tight, Little Cunt

  2 years ago

  xHamsterdirty talkmasturbationJOI

• 13:58 thumb_up 90%

  Kinky whore closeup pussy solo

  3 months ago

  XoZillaamateursolowhore

• 01:57

  Hilarious XXL Udders Office, Ai Cartoon

  3 months ago

  PornDrcartoonjapanese

• 1:59:28 thumb_up 89%

  A Day trip Hot Springs Big Breasts Wife Kanako 35 Years Old

  7 years ago

  TXXXjapanesejapanese wifewife

• 07:37 thumb_up 80%

  Warm Fuck-fest with My Round Enormous-jugged Wifey Completes with an Mighty Ejaculation and Monstrous Jizz flow

  2 months ago

  PornDrbeautywifefrenchbig titsBBWreality

• 06:05

  Bootie Buttplug Upgrade Means Live Culo Poking for Followers

  3 weeks ago

  PornDrcreampiewifeanalczechhandjobreality

• 23:12 thumb_up 75%

  MILF Got Fucked By The Plumbers

  2 years ago

  PornDrhandjobthreesomeczechbig cockplumberhardcore

• 05:18

  Wifey share. Three-way. Utter sequence Fresh encounter

  4 days ago

  PornDrmaturefrenchthreesomehardcorewife

• 03:19 thumb_up 82%

  I caress myself in public on the balcony

  4 years ago

  xHamstervoyeurflashingnudistspandexupskirt

• 11:01

  Milf Nina Craves Jacking Her Pussy

  1 week ago

  JizzBunkersolowifegrannymasturbation

• 06:09 thumb_up 71%

  Curious Goddess Arabian milf pregnant doggystyle pussy wet fucking mutual masturbation

  3 years ago

  xHamsterbrazilpregnantclitbig clitmutual masturbationarab

• 06:07

  After years of no meatpipe, insatiable grannie with flawless bra-stuffers and super hot vagina preps for the hottest nail of her life

  2 weeks ago

  PornDrwifegranny

• 05:50 thumb_up 72%

  Horny Wife in Short Skirt Takes off Her Panties and Starts Rubbing Her Pussy in a Public Toilet

  8 months ago

  $$ FapHousetoiletmompublicsolopantiesnylon

• 12:15

  NewYearsDay Fuck pt. 2 - Fucking, Fingering, Squirting & Huge Orgasm

  1 year ago

  xHamsterwifehomemadegermansquirtmutual masturbationneighbor

• 27:42 thumb_up 54%

  We Made Love and Devoured Each Other with our Bare Desires

  4 years ago

  xHamsterwifeshort hairweddingneighborstoryjapanese wife

• 20:13 thumb_up 68%

  Nymphos house cleaning smut

  8 months ago

  PornHatfilipinaJOI

• 05:37 thumb_up 85%

  She Begs for Anal Fucking

  2 years ago

  xHamsterhomemadePOVanalmasturbation

• 12:17 thumb_up 74%

  OMAHOTEL Arousing Grandma Gone Passionate

  3 years ago

  Analdinstripgranny

• 06:57 thumb_up 89%

  Wife toys her wet cunt after pinching the nipples and clit on cam

  4 years ago

  XBabemasturbationbig clitdildoclitorgasm

• 07:00 thumb_up 75%

  Two horny British sluts fucking hard with two big cocks

  1 year ago

  PornDrbritishlatexhandjobhardcorebondage

• 12:02 thumb_up 69%

  HITOMI :: The Tempatation From A Pretty Slut 2 - CARIBBEANCOM

  4 years ago

  xHamsterjapaneseupskirtjapanese momfingeringjapanese massagejapanese wife

• 09:29 thumb_up 56%

  Satisfied and used at the same time! I had 5 orgasms before he stopped!!!

  3 years ago

  xHamstergermankissing

• 04:13 thumb_up 78%

  Enema and Anal hook. New presents from Daddy

  4 years ago

  xHamsterbisexualshowerfirst time

• 12:54 thumb_up 66%

  Bored step mom comes downstairs after dad left for work and jerked me off

  1 year ago

  XXXDanmomamateurhousewifecaughtjerkingsurprise

• 08:18 thumb_up 68%

  Son-In-Law Seduces His Mother-In-Law for The Hardcore Fucking

  3 years ago

  xHamstermomBBWmother in lawseduced

• 07:50 thumb_up 83%

  Peeping at the wife

  6 years ago

  TXXXvoyeurmasturbation

• 15:47 thumb_up 63%

  ACCIDENTAL GANG-BANG - Splendid Milf Realtor Gets Gang-fucked While Selling A Mansion FRENCH SUBTITLES

  7 months ago

  PornDrgangbanghandjobfrenchmasturbation

• 20:45 thumb_up 72%

  Hairy brunette mature GILF grandma Grace solo - Big saggy tits

  2 years ago

  xTitsgrannymasturbationGILFsaggy titshairy

• 08:00 thumb_up 75%

  Fantastic mature bi-atch Amy needs a raunchy banging with a meaty chisel

  4 months ago

  PornDrfrenchcreampiematurewifeblowjobhandjob

• 36:03 thumb_up 76%

  Sluty aged grannie in pantyhose

  5 months ago

  PornDrmaturebeautypantyhosefrenchPOVbig assgranny

• 10:26 thumb_up 78%

  Christina Sapphires high heels stockings movie by Mature NL Solo

  2 years ago

  PornHatmomsologlassessaggy titsheelssecretary

• 08:00

  Bibi Blow, User Dirk Gb And User Juergy Gb In Reif Und Schwanzgeil - Milf-bibi Creampie Gangbang

  1 month ago

  TXXXsmall titscreampiegangbangwifemasturbationsmall cock

• 17:26 thumb_up 53%

  Magnificent unexperienced wife fingers her slit until orgasm.

  9 months ago

  HDSexwifeamateurhairymasturbationsolodance

• 03:12 thumb_up 55%

  Big Labia and Clit Pussy Wife and Hubby Mutual Masterbation

  7 years ago

  xHamsterBBWclitbig clitmutual masturbationhidden

• 09:11 thumb_up 79%

  Fuck Me Like the Whore I Am

  1 year ago

  xHamsteramateursmokingshowerwhorewatchingGILF

• 06:10 thumb_up 88%

  Doctor fingers a patient for gyno exam

  3 years ago

  PornDrdoctorgynoexamlesbian

• 15:31 thumb_up 79%

  Emotional bimbos hd sex

  1 year ago

  PornHatteaseMILFczechdildosolostripblonde

• 09:22 thumb_up 58%

  Do you want to watch me squirting? I use my husband's sperm as a natural lubricant.

  2 years ago

  xHamstercreampiegermanbukkakesperm

• 28:45 thumb_up 79%

  He wanted to know what was his wife at the computer

  10 years ago

  VoyeurHithiddenvoyeur

• 21:08

  Real Crazy Housewife Does It with A few Fuck sticks

  5 days ago

  PornDrcreampievintagevoyeurmasturbationsolowife

• 33:40

  I Share The Sofa With My Cousin And Concluded Up Dreaming And Shagging Him - Jennifer White

  1 month ago

  PornDrfrenchcousinwifehandjob

• 02:23 thumb_up 61%

  Jacuzzi water masturbation and public pool crossed legs orgasm

  4 years ago

  xHamstervoyeurunderwaterpoolsport

• 08:00

  Step-mother Trains Tantric Threeway

  2 days ago

  PornDrwifefrenchmasturbation

• 10:31 thumb_up 85%

  Irenas gilf movie by Mature NL Solo

  2 years ago

  OkXXXpantyhosesoloGILFgrannyheels

• 09:29 thumb_up 70%

  Meet 76-year-old wife Desiree Eden, our oldest GILF ever

  2 years ago

  xHamstersoloGILFgranny

• 06:16 thumb_up 86%

  Mature girl Leilani Lei flashes how she treats rigid pipe

  4 months ago

  PornDrmaturefrenchcreampiegrannywifeflashingmasturbation

• 13:09 thumb_up 76%

  - Stepson, stop jerking off, better take care of your mom's pussy "Stepmom teaches stepson to fuck"

  4 years ago

  xHamsterrussianstepmomjerking

• 03:53 thumb_up 79%

  Wife Masturbating In The Car On The Way Home From The Nude Beach. 2 Orgasims

  5 years ago

  HClipsbeachwifecarmasturbationwebcamsolo

• 14:39 thumb_up 82%

  College Professor GRANDMOTHER gets SMASHED

  8 months ago

  PornDrhandjobgrannyinterracialwife

• 37:57 thumb_up 87%

  Beautiful Vianas eating pussy xxx

  1 year ago

  PornHatmaturebeautyinterracialwifeMILFridingcum in mouth

• 37:37

  The Secret Underground Bodacious Gals Pub Everyones Conversing About?an Breathtaking Night of Seduction and elite Delectations -ep1

  4 days ago

  PornDrcreampiejapaneseasianwife

• 09:01 thumb_up 85%

  Retro maid prepares potatoes for dinner. Vintage performance. Vintage maid have no panties. Masturbation outdoors. full

  4 years ago

  xHamstermaidnudistupskirtpantiesstrip

• 03:09 thumb_up 87%

  Hidden camera wife & toy

  12 years ago

  Uporniavoyeurhidden

• 05:24 thumb_up 71%

  Group masturbation after no-condom sex ends as covering slutty wife in sperm! - Milky Mari

  1 year ago

  xHamsterhomemadecheatingbig titsspermgroupold and young (18+)condom

• 05:12 thumb_up 73%

  WATCH ME BATH SOLO SO YOU Masturbate!!, Young Naked Girl Bathes her Big Hot Pussy in the Shower Alone - Chubby Latina Re

  3 years ago

  xHamstershowerwatchingbath

• 03:25 thumb_up 75%

  Lusty Stepmom Swallows Cum While Masturbating Nuts On Chin Fellatio Cum Into Mouth Drink - Jim Stone

  1 year ago

  KePornjerkingswallow

• 21:04 thumb_up 71%

  Italian exhibitionist couple 90s audition without a mask

  3 years ago

  xHamsterpissinghomemadeitaliancoupleauditionmask

• 15:37 thumb_up 75%

  Wife Swap My Husband Wants To See Me Fucking Another BBC Guy

  1 year ago

  JizzBunkerblackinterracialcuckoldhusbandcumshotblondewife swap

• 07:22 thumb_up 46%

  78 Years Older Grandmother Has Fun Into The Bathtub With Lotty Blue

  12 months ago

  KePorncargrannybathjerkingbathroom

• 07:52 thumb_up 60%

  Horny grandpa and grandma

  2 years ago

  TXXXgrannygrandpa

• 01:03 thumb_up 62%

  I lick my brother's wife if he only knew. But I don't care. The horny milf cunt tastes so good!

  4 years ago

  xHamsterfemdom

• 05:59 thumb_up 81%

  Femdom wife humiliates hubbys small cock and only lets him jerk off while watching her stretch her own pussy! - Milky Marie

  3 years ago

  XXXDanhandjobfemdomsmall cockhuge dildoinstructionorgasmdildo

• 09:54 thumb_up 68%

  Hot Wife Finds the Hidden Cam and Puts on a Show

  3 years ago

  xHamstervoyeurhiddenczech

• 09:24 thumb_up 65%

  Meet Foxxxy, A 60-year-old Wife, MILF And GILF With Big Tits And A Pierced Clit

  1 year ago

  TheyAreHugeblowjobbeachwifeclitbig clithardcoreGILF

• 21:25 thumb_up 89%

  Wife Machine Fucks Multiple Dildos

  2 years ago

  SunPornodildomachinemasturbationsolo

• 10:25 thumb_up 76%

  Italian 90s porn exclusive with unshaved women #10

  3 years ago

  xHamsteritalian

• 27:35 thumb_up 86%

  Having a good time live

  1 year ago

  JizzBunkergrannywebcamamateur

• 22:11 thumb_up 74%

  Busty Mom Fucked On Date - amateur POV sex with cumshot

  3 years ago

  xTitsmomcreampiePOVdoctorfootjobcum on pussy

• 05:30 thumb_up 72%

  Extreme wet hairy pussy squirting by masturbation in close-up

  4 years ago

  xHamstersquirtwet

• 20:13 thumb_up 86%

  This MILF has a serious jerking problem

  6 years ago

  HClipshandjobwifejerkinghandjob compilationcumshot compilation

• 12:24 thumb_up 78%

  Hairy German wife gets naughty in homemade video

  1 year ago

  XXXVoguedirty talkgermansolohairy

• 14:20 thumb_up 77%

  SCOUT69 - German Mature instruct real elderly married Duo how to Boink in trio Some (Lil Dinky)

  7 months ago

  PornDrmaturehandjobgermanwife

• 10:58 thumb_up 84%

  Dont Cum Inside Im Married! Milf Wife Creampied after Party

  1 year ago

  Beegmasturbationcreampiecouplewifekissingparty

• 43:46 thumb_up 75%

  Amateur Teen Girl Comes To Her New Gyno Doctor For Full Examination

  8 years ago

  XoZilladoctorspyofficegynoshaving

• 22:37 thumb_up 72%

  Hot Mature Grandma MILF first masturbates with a dildo then rides a Big Black Cock BBC guy for a cumshot as facial cum

  4 years ago

  xHamstergrannywifedildodoggingBBCgerman

• 16:36 thumb_up 70%

  The Good Wife

  10 years ago

  TXXXstockingsJOIbritish

• 07:51 thumb_up 71%

  Cuck Watches Mature Wife With Another Older Woman Fuck Each Other

  4 years ago

  xHamsterpantyhosemasturbationfingering

• 23:07 thumb_up 87%

  Chunky MILF Reaches Dildo Orgasm During Kinky Gyno Exam

  8 years ago

  XoZillalesbiandoctornursewifegynoexam

• 25:33 thumb_up 69%

  Wife Orgasm Compilation: OMG how does she cum and squirt so much!!! I wish I could cum that much!

  3 years ago

  xHamsterwifeorgasmcompilationorgasm compilationmutual masturbationfingeringcum on pussy

• 07:23 thumb_up 75%

  Amateur Homemade - Stepmom girl with small tits masturbation while give an epic handjob to her boyfriend

  3 years ago

  xHamsterhandjobwifeswedish

• 06:00 thumb_up 83%

  Nude barbershop. I will touch my pussy naked while the hairdresser colors my hair. 1

  3 years ago

  xHamsterpublicvoyeurbeachnipplesshy

• 12:39 thumb_up 88%

  Stepmother With Folks Mischievous Step-Mother Visits Sonnie In The Office

  1 year ago

  PornDrhandjobfrenchstepmomreality

• 37:01 thumb_up 66%

  Caught masterbating

  3 years ago

  xHamstervoyeurhiddenmasturbation

• 05:09 thumb_up 50%

  Aiden Starr Takes Cherie DeVille Butt sex

  1 month ago

  PornDrfrenchwifefistingbondagelingerieBDSMtattoo

• 06:20 thumb_up 92%

  Selection!!

  7 months ago

  PornDrbrunettefrenchvoyeursolomasturbationhairy

• 12:47 thumb_up 88%

  Lustful wife impassioned handjob video

  2 years ago

  XoZillasaggy titswifemasturbationsmall titshomemadehandjob

• 23:56 thumb_up 85%

  Husband gives wife an anal creampie

  1 year ago

  XXXDanblowjobcreampiemature analteen anal (18+)husband

• 06:22 thumb_up 60%

  #3 Exhibitionist Wife Outdoor Amateur Milf Handjob Big Cock on Nudity Beach public in front of strangers with cum - MissCreamy

  1 year ago

  xHamsterhandjobitalianpublicvoyeurbeachwifeflashing

• 08:10

  Mature Abi James Gives Glamour Hj While Chatting on Smartphone

  3 days ago

  PornDrmaturewife

• 05:53 thumb_up 75%

  I Started to Masturbate, and Then He Filled My Tits and Bra with Cum

  10 months ago

  $$ FapHousehandjobamateurhairymasturbation

• 26:35 thumb_up 83%

  The Nurse Step-mother Gabriela Veracruz

  3 weeks ago

  PornDrgermanwifeMILFcreampiehandjobnurse

• 10:10

  DaCada and Marie Skyler having outdoor joy!

  1 week ago

  PornDrgermanpissinglesbianamateurwife

• 06:15

  Step-mom Caught Eyeing Daughter

  2 weeks ago

  PornDrwifelesbianmasturbationcaughtstepmommom

• 05:09 thumb_up 51%

  My wife's sister wants to fuck and starts showing off

  4 years ago

  xHamsterpussyhairy

• 08:00 thumb_up 78%

  Awesome wife in a red dress Ariella Ferrera penetrated by her hubbys friend

  7 years ago

  OkXXXhiddenkitchendress

• 12:28 thumb_up 74%

  Submissive wife gives wet blowjob with gagging and receives a creamy surprise

  1 year ago

  XXXVoguesurprisecreampie

• 17:21 thumb_up 89%

  New brun goes white old

  4 years ago

  PornDrlesbiangranny

• 15:22

  Mature lezzy luvs to munch and finger pulverize a pretty young tarts clean-shaven labia

  4 days ago

  PornDrcreampiefrenchlesbianmasturbation

• 20:00 thumb_up 75%

  Fancy womans british clip by Aunt Judys

  1 year ago

  PornHatamateurcutestockingsbritishrealityauntpussy

• 23:22 thumb_up 88%

  Hairy Chick Got Her Cunt Pounded In The Bedroom

  3 years ago

  HomemadeXXXebonygermancheatinguniformBBC

• 15:11 thumb_up 75%

  MilfAf- Scottish Cougar Penny Peaks Caught Twat Massaging Then Pulverized Rock-hard

  1 month ago

  PornDrhandjobbeautyfrenchcreampiemassagewifecaught

• 10:31 thumb_up 88%

  Mature NL - blowjob trailer

  3 years ago

  OkXXXgrannyMILFhairyridingmasturbation

• 05:58 thumb_up 67%

  Amatur Arab Hijab Wife Masturabtes Silently To Extreme Orgasm In Niqab REAL SQUIRT While Husband Away

  3 years ago

  TheyAreHugearabflashingsolohairyamateur

• 09:36 thumb_up 74%

  Real Cheating. My Wife And Neighbor Are Have Fun On My Bed. My Husband Is At Work

  3 years ago

  xHamsterhiddenofficeneighbor

• 16:18 thumb_up 87%

  My wife porn actress for a day #4

  3 years ago

  xHamsterpissingclit

• 18:44 thumb_up 49%

  Ullu Adult Web Series sex Scene 701

  2 years ago

  PornDrindianasianwifeMILF

• 10:48 thumb_up 95%

  My creamy pussy loves to take big cocks

  1 year ago

  JizzBunkerebonyfrenchhuge dildodildomasturbationbig cockpussy

• 07:55 thumb_up 64%

  A Collection of Short Films of This Week, Enjoy It Part 29

  2 years ago

  xHamstertattoocreampieshoweroutdooramateur

• 10:19 thumb_up 64%

  Bonnie Banks Gigantic Mountains

  2 months ago

  PornDrfrenchsolowife

• 05:06 thumb_up 70%

  Cheating spouse permit stranger internal ejaculation his fertile wifey numerous times in vulva

  9 months ago

  PornDrhandjobcreampiegermanwifevoyeurhairy

• 03:38 thumb_up 65%

  Naked Sauna Fun With My Friend‘s Hot Mom Part 4, Cory Chase

  6 years ago

  xHamsterwifecheatingsaunacuckold

• 06:37 thumb_up 88%

  Outdoor remote vibrator orgasm

  4 years ago

  xHamstervibrator

• 21:57 thumb_up 74%

  Chubby mom amateur sextape

  4 years ago

  Analdinamateurhomemademassagechubbycuckoldstripgangbang

• 11:51 thumb_up 73%

  USAWIVES Wet arousing slit sitting on her stairs

  2 years ago

  Analdinchubbysolomasturbation

• 20:43

  Scandal video from the 90s with Italian housewives #5

  3 years ago

  xHamsterpissingitalianbig clit

• 02:01 thumb_up 56%

  Mature Perverse Jav Milf Cervix Fuck with carrot and huge dildo

  5 years ago

  xHamsterkoreangynoexamjapanese uncensoredmasturbation

• 05:08 thumb_up 79%

  Huge melons mature machine got laid in woods

  3 years ago

  XoZillahuge dildoinsertionmachinevibratorsolo

• 06:23 thumb_up 84%

  Sexy girl in stockings masturbates pussy and brings herself to orgasm

  4 years ago

  xHamsterstockingswiferussianorgasm

• 10:30 thumb_up 50%

  MetArt X featuring Monika Mays masturbation porn

  1 year ago

  PornHatmomsolomasturbationwife

• 09:02 thumb_up 75%

  Easy access to granny's pussy

  2 years ago

  xHamstergrannywifesolodressmasturbation

Categories

Other free porn sites