Mature • Slapping 2,773 videos

• 36:11 thumb_up 83%

  Mature NL featuring Nikky Dreams casting couch clip

  2 years ago

  OkXXXcastingmatureblowjobMILFczechnerdy

• 05:38 thumb_up 84%

  Cheating wife gets her tight ass drilled while dirty talking in ultra HD

  1 year ago

  XXXVogueclubdirty talkcuckoldass to mouth

• 11:47 thumb_up 73%

  Pussy Slap Squirt ALL IN ONE - The Pregnant MILF Shows All

  3 years ago

  TheyAreHugepregnantlactatingpiercingnipplessolo

• 05:45 thumb_up 87%

  Minea is surprised while doing the dishes, her pussy and ass gets fingered until she pisses

  3 years ago

  xHamsterpissinghomemadegermankitchensurprisemassage

• 10:01 thumb_up 61%

  Get ready for a wild ride with Slap Jack Strip and Suck

  1 year ago

  xHamsterredheadstripFFMgame

• 10:12

  House Of Sinn Cbt Ball Slapping Test Mistress Lexy Noir

  6 days ago

  DrTuberamateurfemdom

• 01:22 thumb_up 62%

  Pulling & Slapping My Big Saggy Udders Pt1 - TacAmateurs

  5 years ago

  HClipspissingfemdomoutdoorBDSMspankingsaggy tits

• 10:33 thumb_up 86%

  Femdom, CBT, Face Slapping and Painful Jerk off

  1 month ago

  $$ FapHousefemdomjerkingfetish

• 30:34 thumb_up 72%

  Ash-blonde heads for a walk in the woods with her chubby girlfriend on a leash

  8 months ago

  MatureClubpublicchubbyoutdoorfistingbondagenipplesass licking

• 07:41 thumb_up 55%

  The Unfinished Punishment

  1 year ago

  xHamsterlesbianspanking

• 08:12 thumb_up 80%

  Her Pain and Her Pleasure Part 2

  1 year ago

  xHamsterlesbianspankingBDSM

• 16:10 thumb_up 71%

  Womens big ass porn by Desperate Amateurs

  2 years ago

  OkXXXamateurteen (18+)moneyshycastingbig tits

• 11:09 thumb_up 78%

  Homemade Bdsm. a Submissive Wife. Rough Anal. Russian Hardcore

  10 months ago

  Beegcreampieanalteen (18+)wifefistingBDSM

• 32:57 thumb_up 69%

  Gorgeous Blond Hair Lady Shagged Like A Slut

  6 years ago

  XoZilladoggingdirty talk

• 16:50 thumb_up 75%

  Take it deep Slut Fuck Toy Blonde Throated and Cum on Face

  1 year ago

  xHamsteramateurfacialswallowcumshotcum in mouthslut

• 02:50 thumb_up 69%

  Slap her tits while getting naked in barn

  3 years ago

  xHamsteroutdoorhookerflashingBDSMspankinggerman

• 05:00 thumb_up 82%

  Amateur BDSM slut public fucked n spanked on front audience

  1 year ago

  PornGemfemdompublicvoyeurfetishbondageBDSMspanking

• 40:02

  Deep ass-fuck wrecking for Cassie Del Isla & Daisy Lee Full episode

  1 week ago

  VideoSectiondeepthroatfrenchanal

• 09:40 thumb_up 64%

  Sucking Big Dick in Bed and On Her Knees she gets Cum in Mouth

  2 years ago

  xHamsterfacial

• 21:16 thumb_up 64%

  UKAnalPainSlut suffers in the woods

  3 years ago

  xHamsterbondagespankingtiedhardcore

• 15:00 thumb_up 93%

  Ebony maid Osa Lovely fucks Jane Wilde

  4 years ago

  Analdinebonymaiddildoanallesbian

• 07:44 thumb_up 79%

  Rough facesitting while face slapping

  5 years ago

  HClipsamateurfemdomfacesitting

• 11:50 thumb_up 69%

  Curvy milf with clamped nipples toys and cums hard

  5 years ago

  xHamsterorgasmmasturbation

• 13:03 thumb_up 83%

  Pov Handjob with Squeezing and Slapping Cock Balls - Ruined Orgasm

  4 years ago

  xHamsterhomemadeitalianCFNMtease

• 05:42 thumb_up 66%

  Mature PAWG Submissive Slut, kittenbritches, is Bound, Face Fucked Roughly& Made to Throat Daddy's BBC

  2 years ago

  xHamsterhomemadeinterracial

• 09:07 thumb_up 70%

  Shaming skinny saggy titted MILF by calling her degrading names as chubby girl sit, slap and spit on her useless face

  1 year ago

  xHamsterfemdomlesbianfacesittingdirty talkafricandomination

• 05:12 thumb_up 77%

  Fuck me hard on the table with my huge tits 85E and squirt my milk on me.

  1 year ago

  xHamstermomgermanlactating

• 15:00 thumb_up 78%

  Curious Teen Gets A Mature Romping

  5 years ago

  PornHatstockingsfacesittingstrip69close updominationskinny

• 31:15 thumb_up 63%

  Beautiful Blond Hair Girl Lardy Mommy Pounded Hard - rough

  6 years ago

  XoZillaitalianfrenchhousewifemom

• 10:37 thumb_up 78%

  Squeezing and Lactating Handjob - liljaswitch

  4 years ago

  xHamstermomlactatingmilknipples

• 03:48 thumb_up 94%

  Wet Meaty Pumped Pussy Hardcore Masturbation Close Up Fingering Slapping Hot Sound and Ben Wa Balls with Mistress Gina

  4 years ago

  xHamsterfemdommasturbationclose upbig clitpussyamateur

• 23:54 thumb_up 79%

  Big Tit Dykes Strap Each Other Slap Breasts and talk Dirty

  4 years ago

  XoZillastrapondirty talklesbian

• 16:06 thumb_up 63%

  Amazing blonde slaps strokes a cock

  9 years ago

  TXXXhandjobamateurbritishblonde

• 41:38 thumb_up 64%

  Mature, smack, spit

  5 years ago

  HDSexBDSMmature

• 12:37 thumb_up 77%

  Milk deepthroat totally destroys her and then he cums down her throat - Hard blowjob with tears

  2 years ago

  xHamsterdeepthroat

• 08:00

  Cougar slaps then eats teenage daughter-in-law

  2 weeks ago

  PornDrtattoofrenchlesbiancougar

• 10:15 thumb_up 75%

  Hot MILF gets her perfect ass spanked and slapped hard

  2 years ago

  SexuhomemadestockingsPOVgermanspanking

• 08:13 thumb_up 67%

  Her Hurt and Pleasure

  1 year ago

  xHamsterlesbianspanking

• 08:14 thumb_up 66%

  Real mature couple has an epic fuck-fest with intense orgasms and deep doggy creampies

  12 months ago

  XXXVogueamateurmomhomemadecreampiesquirtcoupleorgasm

• 38:17 thumb_up 69%

  Cheating milf video with captivating Tia Layne and Pascal White from Pascals Subsluts

  2 years ago

  PornHatbritishspankingdeepthroatcheatingcreampie

• 05:59 thumb_up 92%

  Cruel blonde dominatrix sits on her slaves face, slaps and tortures him

  1 year ago

  XXXVoguefeetlesbianfacesitting

• 58:48 thumb_up 88%

  Milfs Fuck Milf Julia Ann Hard! - DP, DVP, Slapping, & DAP!

  3 years ago

  TheyAreHugefetishfacialgangbanganalmature anal

• 11:12 thumb_up 72%

  Rules of suffering

  1 year ago

  xHamstergrannyBDSM

• 20:43 thumb_up 74%

  Horrible Boss Venus Catches Me Stealing Femdom

  1 year ago

  xHamstermaturefemdomMILFBBWbig titsfacesittingass licking

• 20:08 thumb_up 53%

  Sweet mature slut wife AimeeParadise: hard handjob & fisting compilation...

  3 years ago

  xHamsterfistingorgasm compilation

• 28:58 thumb_up 76%

  Young Submissive Wife. Homemade Bdsm. Russian Hardcore Style

  11 months ago

  BeeghomemaderussianwifefistingBDSMredhead

• 10:35 thumb_up 64%

  First-time creampie with blonde cougar Richelle Rose gets wild with Alexander Gary

  9 months ago

  XXXVoguecastingorgasmbondageBDSMspankingcougarcollege

• 18:10 thumb_up 60%

  Slutty Blonde MILF getting Hard Fuck Slapped Spit and Cum in Mouth

  2 years ago

  xHamsterfeetMILF

• 19:08 thumb_up 74%

  Said No To Anal Extreme Punishment Fuck- Crying Spanking Slapping Choking

  6 years ago

  HDZogspanking

• 31:04 thumb_up 50%

  Complete Gameplay - ripples, Part 23

  5 months ago

  VideoSectionstoryhairy

• 11:32 thumb_up 91%

  Cock's Lactation Rings Handjob

  4 years ago

  xHamsteritalianlactatingmilk

• 01:22 thumb_up 80%

  Pulling & Slapping My Big Saggy Udders Pt2 - TacAmateurs

  6 years ago

  HClipsspankingsaggy titspissing

• 24:22 thumb_up 64%

  NO Mercy fierce manhood and Ball Torture extreme EVIL Ball Stretching and Urethral Sounding CBT Slapping by WICKED mommy

  11 months ago

  VideoSectionmomfemdomBDSMspankingfull moviedomination

• 06:03 thumb_up 92%

  Anal Fucking from Prepping to Finish as Dianne oiled up and gives an unedited reveal.

  3 years ago

  xHamsterkissinganalwifeorgasmspankingdirty talk

• 07:32

  Nonstop Face Slapping - the Cruel Femdom

  5 days ago

  $$ FapHouseBDSMfemdom

• 06:04 thumb_up 76%

  Sexy Solo of Chubby MILF

  1 year ago

  xHamsterslutsolooutdoorpissing

• 17:06 thumb_up 83%

  LP Officer Brings Step Mom And Step Daughter Into The Back Office For A Dick Deep Cavity Search

  1 year ago

  xHamsterFFMstripthreesomemombig tits

• 07:59 thumb_up 81%

  Threesome Garden Party

  7 years ago

  PornHatpartyfacesittingass lickingFFM

• 15:48 thumb_up 52%

  Knocker manhandle with stiff anal

  7 months ago

  MatureClubmature analgrannyasianbondagebig titsBDSMass to mouth

• 10:02

  Tit Slapping: Hard Impacts & Aggressive Deepthroat

  1 week ago

  HClipsanalPOVcreampieamateur

• 09:30 thumb_up 48%

  Aimee Hot MILF - Brilliant passionate dancing of a mature cunt on my fist ...))

  2 years ago

  xHamsterscreaming

• 11:48 thumb_up 72%

  Face Slapping Until He Cries

  2 years ago

  TXXXfemdom

• 05:14 thumb_up 67%

  Helpless Blonde Milf Weeps as Strokes Slap on Her Nipples

  4 years ago

  xHamsterbondage

• 03:55 thumb_up 70%

  Femdom BBW Dominates His Ass!

  2 years ago

  xHamsterbisexualspanking

• 33:28 thumb_up 65%

  Asian Teen Brat Slaps Mom Around - Foot and Ass Worship

  9 months ago

  JizzBunkerteen (18+)lesbianmomBDSMjapanese lesbianjapanese mom

• 05:59 thumb_up 82%

  Spank Me Hard Mommy! Clara Matthews Slaps Aloras Pussy And Tits! - MatureNl

  11 months ago

  TXXXhairybritishbrunettespankingmom

• 15:34 thumb_up 84%

  Pussy Slap Squirt Naughty America - Veronica Avluv Gets A Wet Juicy Creampie

  3 years ago

  TheyAreHugechubby

• 08:00 thumb_up 50%

  Huge Latina Lactating, Swinging And Slapping Tits

  3 years ago

  InPornlactatingspanking

• 1:29:41 thumb_up 74%

  Extremely Brutal Sex Part 2, Hard Spanking, Slapping, Fisting, Pis With Adeline Lafouine

  3 years ago

  Uporniafistingspanking

• 07:17 thumb_up 73%

  Amazing Domination By Spit Slap Ass Licking

  2 years ago

  xMILFbrazillesbian

• 09:29 thumb_up 88%

  House slave & slap & spit & worship feet

  5 years ago

  HogTVfemdomheels

• 15:59

  Delinquent Valerie Gets an Intense Lesson on the Parrot Swing with Her Tits Being Slapped and a Huge Anal Hook Deep in Her Ass

  6 days ago

  $$ FapHouseMILFanalBDSMbondagespanking

• 01:40 thumb_up 67%

  My Breasts Are Slapped

  2 years ago

  xHamstermexican

• 22:33 thumb_up 72%

  Nicole DuPapillon UKs Longest puss - domination & submission CLUB female dom

  11 months ago

  MatureClubfemdomsquirtbig assMILFbig titsBDSMfacesitting

• 07:24 thumb_up 86%

  Extreme Deep Throat Fucking Compilation

  1 year ago

  xHamstercheatingfacialcompilationcum in mouthcumshot compilation

• 10:00 thumb_up 76%

  Stunning lesbian action with two chicks Bonnie Rotten and Gina Valentina

  7 years ago

  OkXXXstraponmutual masturbationlesbian

• 05:23

  Chubby Slut Gets Her Punishment - Her Huge Natural Boobies Slapped, Squeezed And Pinched

  3 years ago

  Uporniasluthomemade

• 08:12 thumb_up 71%

  Natasha, an adulterous woman is looking at her punishment Stan!

  1 year ago

  xHamstermaturespankingbondageBDSM

• 05:19 thumb_up 84%

  Extreme pussy pumping and huge swollen lips slaps

  2 years ago

  XXXDanclitcameltoebig clit

• 05:28 thumb_up 25%

  Extreme Hard Face Punching And Slapping To Make Me Saying Stop

  2 years ago

  HClipsspankingBDSM

• 15:47 thumb_up 53%

  Tit abuse with hard anal

  1 year ago

  xHamsterorgasmbondageBDSMnipplestiedsaggy titsgranny anal

• 08:00 thumb_up 87%

  Screw Stepmother Id Like To Fuck Hard! - Double Penetration, Dvp, Slapping, & Dap! - Julia Ann

  6 months ago

  uAnalgroupdouble penetration

• 31:10 thumb_up 60%

  Busty babes with natural tits in threesome animated hentai sauna scene

  1 year ago

  XXXVogueFFMbisexual

• 05:59 thumb_up 63%

  DiamsGirl is a lil or a immense tramp in your opinion?

  1 year ago

  MatureClubstockingsblowjobbootsstepmomheelswhoresecretary

• 07:41 thumb_up 65%

  A fat bitch caresses her nipples with electric shocks.

  2 years ago

  xHamsterelectromom

• 06:17 thumb_up 64%

  Sandals Goddess Shoe Dangle Latina Soles in Flip Flops Sexy Shoe Play Sandal Slapping ASMR Bare Feet Foot Fetish HD JOI

  3 years ago

  xHamsterfootjobshoesJOI

• 05:14 thumb_up 82%

  Cougar saggy boobs slapping weenie ride

  5 years ago

  VideoSectionstepmomsaggy titsmom

• 13:13 thumb_up 71%

  Point of view hj with Squeezing and Slapping Cock and Balls - Ruined ejaculation

  3 years ago

  MatureClubfemdomitalianCFNMbondagehomemade

• 07:24 thumb_up 70%

  Orgasm My Way

  1 year ago

  xHamstermaturemasturbationbondage

• 38:09 thumb_up 53%

  Swallow My Pee or I Slap Your Face!

  1 year ago

  $$ FapHousepissingteen (18+)big assfacesitting18swallowheels

• 05:17 thumb_up 72%

  PAWG gets slapped on the ass and arouses her boyfriend.

  3 years ago

  XCafebig assPAWGass

• 17:27 thumb_up 68%

  German mature cougar slaps ass in a sadistic BDSM scene

  8 months ago

  XXXVoguematurebig titsBDSMbondagegerman

• 09:25 thumb_up 64%

  A Slap Jack Strip and cock suck

  1 year ago

  xHamsterredheadstripFFMgame

• 20:58 thumb_up 43%

  Lesbian MILFs big boobs fetish video

  5 years ago

  XoZillanaturallesbian

• 15:41 thumb_up 73%

  Tit slapping nipple pinching dirty talk babes

  5 years ago

  Uporniastraponnipplesdirty talk

• 07:22

  Sophia Locke teaches Macy Meadows how to suck and eat pussy in a hot realitykings scene

  2 years ago

  HogTVdildo

• 07:45 thumb_up 60%

  Granny Pixie: He Made My Pussy Drip Cum. 01152023 CAMS126

  1 year ago

  xHamsteramateurwifecreampiegrannylingeriemissionary

• 06:50 thumb_up 38%

  Bitch Axell Fox undresses and dances a dirty striptease. French blonde sucks, pisses and drinks urine outdoors. Perverted fetish

  1 year ago

  xHamstermatureoutdoorfrenchpissingdancecelebrity

• 05:47 thumb_up 53%

  Ass slapping, butt hole finger sniffing, bush busting out of my bikini lap dance. BRAND NEW CONTENT from Rachel Wriggler

  1 year ago

  xHamsterhomemademassagehairybikinipantiesfingering

• 32:27 thumb_up 91%

  Cum-Loving Farm milf Gets Many Orgasms and Positions spin In The Hay: Sucks, Fucks, Plays With globes

  1 year ago

  MatureClubMILFkissingfarm

• 14:22 thumb_up 62%

  Ukranian housewife face slapping and dominating sub husband

  9 years ago

  Analdinhusbanddomination

• 05:26

  The milk is squeezed out of my huge tits 85E

  1 year ago

  xHamsterBBWhomemadesaggy titslactating

• 08:32 thumb_up 88%

  Painful Fisting For Petite Sub Girl

  3 years ago

  xHamsterfistingbig clitskinnysmall titsclitbritish

• 12:33 thumb_up 92%

  Fuck fuck fuck

  3 years ago

  xHamsterfemdomfatsquirtwetnipples

• 06:30 thumb_up 83%

  He Rubs With Snow And Sucks Presses And Slaps My Soft Saggy Warm Titties Until I Cum Hard

  4 years ago

  HClipssaggy tits

• 05:12

  Homemade Amateur MILF fellatio and oral job Compilation with Cumshot 2024 2

  3 months ago

  MatureClubcumshot compilationcreampiecum in mouthcouplecreampie compilationcompilation

• 10:33 thumb_up 64%

  Impeccable Julia Parker and Julias hd smut

  3 years ago

  OkXXXorgasmbondageBDSMmachine

• 05:26

  Lovely Hard Face Slapping with Orgasms

  3 weeks ago

  $$ FapHousecouplemasturbationamateurorgasm

• 07:47

  Desi aunty with long hair enjoys cheating and swapping partners in wild desi sex escapade

  1 year ago

  XXXVoguewife swap

• 08:02 thumb_up 75%

  Cruel dominatrix in thigh-high boots dominates and torments slaves

  1 year ago

  XXXVogueboots

• 06:47 thumb_up 83%

  I love to pull and slap her hairy pussy while i fuck her

  1 year ago

  xHamsterhairyhomemade

• 08:00 thumb_up 68%

  Best Of Getting Naked For Tit Slapping

  3 years ago

  xMILFnudistBDSM

• 06:04 thumb_up 59%

  A thief Mrs Mary subdued the possessor of the building! Part 1!

  1 year ago

  VideoSectionfeetfemdombootsfacesittingspankingspandexleather

• 06:29

  Married woman humiliated with slaps on the face and a big dick forcing entry into her small mouth and shallow throat.

  2 years ago

  xHamstersmall tits

• 22:31 thumb_up 70%

  Whats her name? - foot fetish, oral sex, monster boobs slapping with big ass blonde mature cougar

  3 years ago

  xTitsfeetmonster

• 40:02

  Ginormous Booty MILFs Take In Deep In The Ass utter sequence

  1 week ago

  HDSexanal

• 13:07 thumb_up 42%

  Hot housewife Lukerya records flirting clips, sits on the washing machine, chats merrily and shows naked striptease.

  3 years ago

  xHamsterstripdressmachinehousewifesaggy titsPAWG

• 15:04 thumb_up 42%

  Beautiful Blonde Model Shows Up In A Hotel Room And Gets Hardcore Bondage Maledom Session

  4 years ago

  xHamsterbondagecougarhotelfingeringskinny

• 36:33 thumb_up 78%

  Amazing Domination By Spit Slap Ass Licking

  2 years ago

  TXXXbrazillesbian

• 05:19

  His fingers in my ass while I masturbate, neighbor subdues wife

  1 year ago

  xHamsterhomemadehairydildospanish

Categories

Other free porn sites