Mature • I Want To Fuck You 10,296 videos

• 09:23 thumb_up 75%

  Jealous stepson wants to fuck his mother

  6 years ago

  TXXXjapanesejapanese momfantasyasian

• 25:12 thumb_up 88%

  Trio MILF Wants To Try Double Penetration - Kenzi Foxx

  3 years ago

  TheyAreHugeblowjobanalinterracialbig titsdoggingdouble analcumshot

• 05:11 thumb_up 50%

  Naturist wife wants to get anal fucked outdoors by her bisexual husband’s hairy ass

  5 months ago

  XXXVoguepublicfrenchmature analbisexualbeachanalwife

• 04:40 thumb_up 79%

  Horny grannies all want these young dicks to fuck em up

  1 month ago

  LetsPornstockingsblackgranny18old and young (18+)orgy

• 11:36 thumb_up 84%

  Widowed Stepmom Flashes Naive Teen Stepson So Hell Want To Fuck Her! With Ricky Spanish And Rachael Cavalli

  2 years ago

  TXXXstepmomMILFfantasyspanishass

• 24:56 thumb_up 77%

  Acrobatic Step Mommy Paulina Wants To Fuck Hard Tender Stepson

  6 years ago

  HogTVmommassageMILFstepmomassold and young (18+)reality

• 06:18 thumb_up 62%

  Mature cuckold wife wants to get fucked outdoors in her hairy pussy

  2 years ago

  xHamstermatureamateurpublicfrenchbeachwifeoutdoor

• 28:07 thumb_up 48%

  Please slow down, I dont want you to cum in my still fertile pussy, i might get pregnant, is that your sperm flooding my inside?

  1 year ago

  xHamstermatureamateurmomarabfatcreampiemature anal

• 08:00 thumb_up 81%

  Do Your Step-grandma Just Like You Did Me - Gilfs Dont Want To Clean, They Want To Fuck - Wendy White And Wendy Raine

  10 months ago

  KePornGILFgrannybig titsstepmomassmom

• 15:02 thumb_up 81%

  Young Shameless Blonde Wants To Fuck Senior Dame In Corridor

  8 years ago

  Analdinpantyhoselesbianrussianglassesswallowblondeold and young (18+)

• 07:51 thumb_up 46%

  My drunk neighbor wants to fuck!

  7 years ago

  HClipsvoyeursmokingrussianwifedrunkcompilationupskirt

• 15:25 thumb_up 85%

  Please Be My Stepmom - I Want To Fuck You!

  4 years ago

  Uporniagermanorgasmstepmomfantasy

• 05:58 thumb_up 76%

  Foursome fucking and cumshots thats what you want to see here and Not long speeches

  2 years ago

  xHamstergermanfoursomesperm

• 12:30 thumb_up 63%

  I want to fuck mommy

  5 years ago

  JizzBunkermom

• 10:14 thumb_up 69%

  Are You Serious You Want To Fuck Me in Ass? I'm your Stepmom! OK but Please don't tell anyone !

  2 years ago

  xHamsteramateurmomitalianmature analhousewifelatinaanal

• 13:11 thumb_up 92%

  Mummy wants to be fucked horny. Gladly directly from the street

  4 years ago

  xHamsteroutdoorcarshoweramateur

• 07:09 thumb_up 88%

  I Really Want To Fuck My Hot Aunt #3

  3 years ago

  xMILFauntskinnyhairy18

• 14:30 thumb_up 90%

  Naughty Granny Wants To Be Fucked In Every Hole

  5 years ago

  Uporniagrannyold and young (18+)

• 05:05 thumb_up 71%

  Orgy and partouze with 4 on a boat in a rough sea, you are not prepared

  1 year ago

  xHamsterpissinghomemadepublicfrenchswingerbeachsquirt

• 05:14 thumb_up 58%

  French Husband Wants Guys To Fuck His Algerian Wife And Cum In Her Hairy Pussy

  1 year ago

  xHamsteramateurfrenchcreampieswingerwifehairycuckold

• 05:56 thumb_up 72%

  Busty Student ExpressiaGirl Fucks and Cums on a Bike in a Public Park!

  2 years ago

  xHamsterclose upvoyeur

• 05:35 thumb_up 60%

  Stepson Wants Guys to Fuck His Hairy Stepmother in Front of Him

  6 months ago

  $$ FapHousehairysaggy titshomemadematurehandjobbrunette

• 25:05 thumb_up 82%

  French Amateur Porn Porn - 41 yo. analized and voracious as - Ass Fucking

  3 years ago

  HomemadeXXXamateurfrenchanalMILFass

• 08:00 thumb_up 75%

  The Old Lady Always Wants To Get Fucked In Her Eager And Hot Ass

  8 months ago

  PePornfeetgrannyoutdoororgasmfistingglassesass

• 06:15 thumb_up 93%

  Beauty Granny Maid Wants To Be Fucked By A Hard Cock

  2 years ago

  xMILFgrannymaidhairybrunettefacialstockings

• 06:36 thumb_up 76%

  Anal to the mature grandmother of 60 years old, widowed and wanting to fuck

  2 years ago

  xHamsterarabmature analgrannyjapaneselatinajapanese momgranny anal

• 10:32 thumb_up 48%

  No Dont Fuck me i am Married ! Only Fingering my Pussy if you want but i have p. ! latin cougar said to his massagist and watch what happen ! (This is the Trial Video)

  5 years ago

  MatureClubpantyhosevoyeurmassagechubbybrazilorgasmspanking

• 05:15 thumb_up 68%

  Break my ass I want to feel it all inside

  3 years ago

  xHamstermomitalianbig tits

• 20:57 thumb_up 70%

  Best friends wife wants you to fuck her

  5 years ago

  BravoTubecouplehomemadecreampierealitybrunettePOV

• 05:11 thumb_up 53%

  Husband Wants Guys To Fuck His Nudist Wife And Cum Inside Her Hairy Pussy

  1 year ago

  xHamsteramateurcreampieswingerwifehairycuckoldnudist

• 27:40 thumb_up 87%

  Divorced wife finally wants to have an orgasm again

  3 years ago

  xHamsterwifefistinghairydildoglassesmasturbationmachine

• 05:10 thumb_up 88%

  My stepmom wants me to fuck her big pussy in missionary and a good creampie. Homemade sex Close up

  1 year ago

  xHamsteramateurhomemadecreampiespanishstepmomclose upmissionary

• 23:00 thumb_up 75%

  Grandma goes to the gym to fuck, grandpa thinks she wants to get fit for him!

  1 year ago

  xHamstergermanmature analgrannyhairyswallowcumshotgrandpa

• 19:00 thumb_up 90%

  Grandma wants to fuck with me and my girlfriend

  12 years ago

  xHamsterthreesomegranny analgranny

• 33:02 thumb_up 75%

  If you want to bake a cake, you need protein

  4 years ago

  xHamsterfrenchanalMILFass to mouthcum in mouthkitchen

• 11:04 thumb_up 83%

  Wife does not wear panties in public and all the black guys around want to fuck her while her cuck is watching

  2 years ago

  YourLustpantiesinterracialhomemadewifepublic

• 05:12 thumb_up 95%

  Hooray! There is a double penetration! Wife is not ready for the real, but wants to be filled

  3 years ago

  xHamstermachinewifedouble penetrationamateur

• 23:21 thumb_up 94%

  StepMom Is A Horny Slut And She Wants To Have Some Anal Fun With Stepson

  3 years ago

  xHamsteramateurmommature analanalrussianredheadstepmom

• 17:58 thumb_up 73%

  Plumpy MILF Wants To Kiss And To Fuck Innocent Student

  8 years ago

  AnaldinmaturekissingcouplerussianchubbystudentMILF

• 20:42 thumb_up 80%

  Perverse couple and a old woman ready to have fun with them Ep 4

  3 years ago

  xHamsterthreesomesaggy titsgerman

• 33:21 thumb_up 83%

  Your Stepmom Is a Very Hot Bitch - I Want to Fuck You Both

  1 year ago

  xHamsterteen (18+)lesbiananalthreesometeen anal (18+)MILFfacesitting

• 18:22 thumb_up 52%

  My husband's cuckold wanted to be angry, I put him in his place, after having sex with a friend

  2 years ago

  xHamstercarhomemadedirty talkcreampielingerieMILF

• 08:00 thumb_up 79%

  70-year-old Wants To Know It Again And Fucks Young Stud Vigorously

  5 months ago

  PePorngrannymomGILFold and young (18+)saggy tits

• 14:28 thumb_up 79%

  Knocked up Aurora wants to fuck two YOUNG ROOKIES!

  5 years ago

  MatureClubspanishpregnantmom

• 10:14 thumb_up 73%

  I Give My Juicy Pussy To A Stranger, He Fucks Me Great. Such A Thick Cock Left Me Wanting More

  1 year ago

  DesiPornTubeindianstranger

• 23:31 thumb_up 68%

  Granny wants to be fucked hard again after a long time

  1 year ago

  xHamsteramateurgrannyasianorgasmhairyjapaneseBBW

• 01:30 thumb_up 66%

  I Want You to Fuck Me so Bad

  10 months ago

  $$ FapHousedirty talkhairymasturbationamateurbrunetteglasses

• 12:59 thumb_up 83%

  Young Boy Wants To Fuck Chubby Granny Up Her Pucker

  8 years ago

  Analdinrussianmasturbationgrannygranny anal

• 22:18 thumb_up 82%

  Wifesharing because his wife wants to feel a big cock

  2 years ago

  xHamstermombig titsgermancum in mouthwatchinghairy

• 21:12 thumb_up 54%

  I want to fuck mommy

  5 years ago

  JizzBunkerbrunettemomMILFbabe

• 09:28 thumb_up 82%

  Jewel Wants To Fuck & Suck That 20 Year Old Cock

  2 years ago

  Uporniahandjobold and young (18+)big cockblowjob

• 10:30 thumb_up 67%

  My cousin comes to my house wet wanting me to get milk out of her huge tits

  2 years ago

  xHamsterPOVsquirtlactatingcousinjapanese

• 14:02 thumb_up 65%

  Marasexx wants a happy ending and just to get fucked

  1 year ago

  XXXVoguecuckoldMILFBDSM

• 04:39 thumb_up 78%

  PLEASE cum inSide Me! I want to feel your hot sperm between my legs. Cream Pie. Sperm flowing out of the pussy. Close-up

  4 years ago

  xHamsterstudentpantiesteacherswallow

• 21:23 thumb_up 78%

  I only want to fuck you stepmom!

  2 weeks ago

  TXXXcumshotmaturestepmomblonde

• 11:34 thumb_up 68%

  Grandpa Want To Have 3some With Grandmas Friend

  3 years ago

  TheyAreHugegrandpagranny

• 29:20 thumb_up 77%

  Hey Babe, want to watch me fuck another GILF?

  4 years ago

  xHamsterGILF

• 18:58 thumb_up 85%

  Wife wanted to try her friend's penis and double penetration in anal

  3 years ago

  xHamsterhomemadeswingerteen anal (18+)cheatingdouble penetration

• 13:37 thumb_up 85%

  Wife Wants to Try DP for the First Time...But She didn't say ANAL or Pussy

  2 years ago

  xHamsterwifeorgasmfrenchdouble penetrationmachine

• 05:27 thumb_up 66%

  Mature grandmother wanting to fuck goes into her daughter's room and finds her son-in-law in bed

  2 years ago

  xHamsterhomemadeanalgrannymother in lawgranny analarab

• 11:03 thumb_up 84%

  POV stepmom mature milf wants to fuck big dick son petite b

  4 years ago

  xHamstermaturePOVgermanstepmom

• 26:46 thumb_up 76%

  Marina T. is a 70 year old cockhungry grandma who wants to nail the neighbors hard male pole off! - Blowjobs

  11 months ago

  XoZillaneighborgrannymatureshaving

• 34:01 thumb_up 87%

  Letty Dont Fuck With Mommy When Mommy Wants To F

  2 years ago

  UporniamaturemomPOVbig cockcougarold and young (18+)

• 06:50 thumb_up 71%

  Oktoberfest Boobies Wants Out and To Be Fucked Hard

  1 month ago

  SunPornocaughtMILFnatural

• 05:17 thumb_up 45%

  Your big boobed dominant dickgirl wife wanted to fuck all your holes, hubby! Are you ready? - Milky Mari

  2 years ago

  xHamsterlactatingfutanariamateurhuge dildo

• 36:12 thumb_up 94%

  I really want to fuck my Hot Aunt #3

  3 years ago

  xHamstermomorgasmauntskinnypussyblowjob

• 08:00 thumb_up 85%

  Handyman, Do You Want To Fuck 49 Year Old German Housewife Jenny In Her Backyard? Her Husbands Gone

  1 year ago

  ManySexmaturegermanhousewifehusband

• 18:44 thumb_up 63%

  My Indian Sexy Hot Step Mother wants My Biggest Dick and teach me How to Fuck ( Hindi Audio )

  3 years ago

  xHamsterpublicrussianpregnantmaid

• 28:20 thumb_up 77%

  Gisela has always wanted to do a threesome, today she gets a second cock to ride as a surprise!

  1 year ago

  xHamsteramateurblowjobthreesomeswallowridingMMFsurprise

• 09:57 thumb_up 63%

  POV Teacher wants to teach you a lesson

  1 year ago

  xHamstermatureamateurmomasianBBWcollege

• 10:56 thumb_up 89%

  My Husband Best Friend Found That We Make Porn And Wanted To Fuck Me Or He Will Expose Us 11 Min

  3 years ago

  Uporniahomemadecuckoldwebcambig tits

• 24:59 thumb_up 84%

  Stepmom Seduction - Mommy Wants To Be Fuck Friends With

  3 years ago

  HDZogstepmomlesbian seductionlesbianmombig tits

• 14:05 thumb_up 49%

  Beautiful Wife Checked By Perverted Gynecologist Doctor Who Wants To Fuck Her Next To Her Dumb Husband Who Trusts The Doctor

  2 years ago

  xHamsterjapanese uncensoredcuckoldjapanese

• 06:40 thumb_up 75%

  He alway wanted to fuck his girlfriends hot wife. Now she gives him

  6 years ago

  BravoTubeFFM

• 05:31 thumb_up 84%

  My wet pussy want to ride you, my tits want to bounce on front of you

  2 years ago

  xHamsterPOVmompolishsaggy titsnipplesamateur

• 18:31 thumb_up 68%

  His stepdaughter arrives in a skirt and without underwear to fuck with him in his wife's bed

  2 years ago

  xHamsterindian18

• 1:00:20 thumb_up 91%

  I get to fuck who I want to fuck

  14 years ago

  Beegmoneydresslingerieaudition

• 36:45 thumb_up 77%

  SUPER-HOT-GRANNY. Fina is back, and wants more dudes to fuck

  4 years ago

  xHamsterspanishgrannyMILF

• 06:11 thumb_up 70%

  I make you a statement I want to fuck and reach my broom friend

  2 years ago

  xHamsterhiddenmature anal

• 30:00 thumb_up 64%

  Charlie wants to fuck teen buddy hard

  3 years ago

  XXXDanteen (18+)MILFanalmature anal

• 08:01 thumb_up 70%

  Is Leaving Me For Cheating With Her. But I Want To Fuck Her Last Time. Will She Agree? Alex Black Watch Full Video In 1080p Streamvid.net

  2 years ago

  xMILFczech

• 17:50 thumb_up 83%

  Petite milf, i want to suck her hard nipples

  3 years ago

  xHamsterskinny

• 06:59 thumb_up 68%

  Mature lady wants to try young cock and is ready to show high class

  13 years ago

  AnyPornmatureorgasmbig cockdeepthroat

• 19:35 thumb_up 83%

  He wants to fuck her, because he knows old brooms sweep well

  1 year ago

  xHamsterhandjobamateurmomblowjobgermangrannywife

• 09:58 thumb_up 57%

  I found her changing clothes in her room, and I wanted to fuck her wet vagina

  2 years ago

  xHamsterhomemadeanalsaggy tits

• 12:49 thumb_up 81%

  Dirty Doc Wants to Fuck Today

  1 year ago

  JizzBunkergynodoctor

• 08:49 thumb_up 83%

  A clear voice, who wants to contain this term, it is appetizing cock that cuffs for me

  1 year ago

  xHamsterBBWbisexualhomemadeteen (18+)cheating

• 10:01 thumb_up 88%

  Cougar wants to try all the skills of her future employees

  4 years ago

  xHamsterfrench

• 25:15 thumb_up 76%

  My Friend Is Either Completely Stupid Or Wanted Me To Fuck Her!

  1 year ago

  xHamstermomstepmomhomemadePOVamateurslut

• 11:43 thumb_up 68%

  MY NEIGHBOR WANTS TO LEARN HOW TO RIDE A MOTORCYCLE AND I END UP HER TO TEACH HER

  2 years ago

  xHamsterhomemadeteen anal (18+)japaneseBDSMstepmomridingjapanese mom

• 06:07 thumb_up 60%

  I wanted a small, narrow hole in my ass and never gave it to anyone, but I got my anus stretched

  4 years ago

  xHamsteranal

• 15:37 thumb_up 76%

  Wife Swap My Husband Wants To See Me Fucking Another BBC Guy

  10 months ago

  JizzBunkerblackinterracialcuckoldhusbandcumshotblondewife swap

• 05:11 thumb_up 64%

  Nudist Wife Wants Guys to Anal Fuck Her Bisexual Husbands Hairy Ass Outdoor

  6 months ago

  $$ FapHousehandjobbisexualcouplewifeoutdoorhairynudist

• 07:50 thumb_up 46%

  Horny mature slut wants to get fucked in her hairy pussy by black guys

  1 year ago

  xHamsteramateurmature analinterracialMILFclitdirty talkcougar

• 11:27 thumb_up 71%

  Russian Skinny Boy Wants To Lose His Virginity With Older Woman

  8 years ago

  Analdinrussiansleepingskinnynerdy

• 34:26 thumb_up 71%

  Badly Fucked Mom Wants To Get Fucked By Big Indian Cock

  1 year ago

  xHamsterindianorgasmshy

• 09:04 thumb_up 68%

  Auntie Angie Sexy Granny Wants To Get Fucked

  5 years ago

  HogTVgrannykitchenmexicanmaskhousewifepussy

• 11:59 thumb_up 91%

  Mom Wants To Breed - milf trailer

  1 year ago

  PornHatmomblowjobbig asschubbymissionary

• 14:13 thumb_up 76%

  Come on, I want to suck it and feel it all in my throat

  2 years ago

  xHamsterswallowcum in mouthitalianamateur

• 20:47 thumb_up 62%

  Get out from my room now! Flat owner fucks innocent Bhabhi

  2 years ago

  xHamsterindian

• 15:01 thumb_up 80%

  She wants us to see her ENORMOUS BOOBS again!! Jeninifer the cleaning lady

  3 years ago

  xHamstercastingspanishlatinamatureblackinterracial

• 20:03 thumb_up 86%

  Blonde mature cougar Summer Stevens - I Want To Fuck You - Summer amateur hardcore

  1 year ago

  xTitsmatureamateurwifeblowjobMILFcougar

• 11:47 thumb_up 75%

  Stepmom with Big Ass Wants to Get Fucked by Her Stepson!

  11 months ago

  $$ FapHousebig assamateurbig cockassPAWG

• 37:11 thumb_up 82%

  Pregnant in the 9th, husband doesnt want to fuck, Im happy to help

  1 year ago

  JizzBunkerdoctorwifefistingpregnanthusbandvintage

• 08:00 thumb_up 69%

  Stepmom Wanted To Play And Lay Down On Her Back To Be Fucked In Anal

  5 months ago

  Fuxxxstockingsanalredheadold and young (18+)nylonclothed

• 09:40 thumb_up 66%

  She doesn't want to lose her job

  4 years ago

  xHamsterarabczechmaid

• 20:06 thumb_up 91%

  Bro! I want to Fuck your Hot Stepmother in the Ass too! Anal surprise for Hot Stepmom!

  2 years ago

  xHamsteramateurthreesomestepmomsurpriseslut

• 32:29 thumb_up 71%

  Do not Tease Me, It will Make Me Want To Fuck - The Cleaning Lady Thick Ass.

  3 years ago

  xHamstertoiletkissingteasecheatingjapanesemaid

• 40:17 thumb_up 59%

  KRS026 Mr. Late Blooming MILF. Don't you want to see it? The very erotic figure of a plain old lady 07

  3 years ago

  xHamsterasianjapaneseeroticsaggy titsjapanese wifebig tits

• 08:12 thumb_up 70%

  Dee Williams and Syren De Mer Perfect Tagteam POV Threesome

  1 year ago

  xHamsterswallowcum in mouththreesome

• 06:15 thumb_up 85%

  Adorable blonde slut wants to get fucked by a really horny grandpa

  9 years ago

  PornIdXXXgrandpaslut

• 11:04 thumb_up 78%

  Old Mature Diva Wants To Be Dicked Down During Her Vacation

  5 years ago

  xHamsterblowjobgrannybig titsdoggingbig cockassvacation

• 28:00 thumb_up 79%

  My stepmom is a big Bitch, always very horny, and father doesn't fuck her the way she wants and she asks me to fuck h

  3 years ago

  xHamsterbig cock

• 06:11 thumb_up 81%

  THE BOSS WANTS TO SEE YOU CUM & PUTS ON A FILTHY SHOW TO HELP YOU XXX

  2 years ago

  xHamsterMILFshort hairbritish

• 17:39 thumb_up 79%

  In the ass too please! Looking for strange men to fuck!

  4 years ago

  xHamstermature analass to mouthhotelstrangermature

• 12:25 thumb_up 62%

  I was 19 years old I got a teenager I wanted to suck Dick my friend pulled me and tied me and my clothes are not in me

  2 years ago

  xHamsterbisexualanaltied

• 20:43 thumb_up 80%

  Aggressive Teacher Wants Student to Fuck Her Anal

  9 months ago

  $$ FapHousemature analanal

• 10:38 thumb_up 75%

  Hot MILF Wants Him to Fuck Her with Her Legs Spread and Cum Inside Her Hairy Pussy. Homemade Sex.

  9 months ago

  $$ FapHouseamateurmomchubbywifeclose up

• 24:27 thumb_up 63%

  My Wants to Give Me a Massage but I Know He Wants to Fuck Me because We Are A...

  9 months ago

  Beegjapanese wifewifejapanesemassagejapanese massage

• 27:46 thumb_up 60%

  Kortny Wants To Fuck Good Hot Friend - Anal

  3 years ago

  xTitsmature

Categories

Other free porn sites