Mature • Hairy Creampie 25,903 videos

• 1:50:29 thumb_up 62%

  Fuga-56 Wifes Best Friend-lust Strike Sexual Intercour

  3 years ago

  Uporniajapanese wife

• 08:12

  Public Exhibition - Lots Of Big Cocks For The Hot And Eager

  3 years ago

  xMILFhairy creampie

• 09:41 thumb_up 70%

  Please Cum In Side

  3 years ago

  xHamstercreampiearmpitcollegejapanese momjapanese wife

• 08:27 thumb_up 67%

  3 orgasms with cum in the pussy

  3 years ago

  xHamstercreampiemachinehairy

• 26:44

  Getting a hard pounding from behind is what makes this sexy

  3 years ago

  xHamsterdominationcreampie

• 09:08

  MarVal - I love suck and fuck this cock in cow girl position

  3 years ago

  xHamstersaggy tits

• 1:04:08 thumb_up 67%

  Pornstars Hiyori Kojima - Busty Wife

  3 years ago

  TheyAreHugejapanese wife

• 07:15 thumb_up 78%

  Mummy and daddy back in action

  3 years ago

  xHamstermaturefatcreampiechubbyhairy

• 20:22 thumb_up 86%

  Omas Im Camp (scene01)

  3 years ago

  Uporniachubbybig titsgrannyvintage

• 07:08 thumb_up 87%

  Are you loser too stupid to fuck my ass?

  3 years ago

  xHamstergerman

• 38:19 thumb_up 50%

  Prod Sogni Anali Di Jessica Rizzo Pate 01

  3 years ago

  Uporniadouble analvintage

• 12:59

  Amateur big cock xxx by Touch My Wife

  3 years ago

  PornHatdirty talkBBC

• 29:11 thumb_up 75%

  40yo Step Mom Sucking The Step Bro 29 Min

  3 years ago

  HDZogcreampiemature analanalhairystockingsmom

• 1:04:50 thumb_up 38%

  Oiled Up And Ready To Fuck Live - Angel Wicky

  3 years ago

  Uporniamatureoil

• 22:54

  Hardcore And Big Booty Inked Bitch Gets Hard Cock - Harlow Harrison

  3 years ago

  TheyAreHugetitjob

• 10:59 thumb_up 87%

  Dont Cum In Me Youre Not Wearing A Condom

  3 years ago

  TXXXcondomcreampieBBW

• 37:55

  Kristen Conner Fucks Student - Rachael Cavalli And Tyler Nixon

  3 years ago

  VXXXteacher

• 1:01:38 thumb_up 50%

  Elegant female prison director gets fucked hard by four visitors

  3 years ago

  xHamsterjapanese uncensoredjapanese massage

• 41:10 thumb_up 86%

  Joslyn Jane - Naturally Titty Starkers Wrestles Tatami Bbc To

  3 years ago

  TXXXwrestlinginterracial

• 13:47 thumb_up 83%

  Peeing while Fucking. I Pissed on his Cock then got Piss and Cum inside my Pussy. Close-up

  3 years ago

  xHamsterpissingshowercum on pussy

• 1:03:51 thumb_up 85%

  Female boss seduces a young employee and the hotelboy for a hard threesome

  4 years ago

  xHamsterthreesomeasianjapaneseseducedjapanese uncensoredhotel

• 04:08 thumb_up 82%

  Brazilian_Miss cumming n peeing with toy in wet pussy

  4 years ago

  xHamsterpissing

• 32:11 thumb_up 62%

  Traditional Asian Girl Fucked On Couch

  4 years ago

  VXXXjapanese uncensored

• 06:21

  Chubby Anal SLAVE Standing bum nailed. wonderful Saggy Tits

  4 years ago

  MatureClubsaggy titsrussian

• 1:22:12

  Time-stop With Beautiful Whores Pt 1

  4 years ago

  Uporniajapanese

• 15:17 thumb_up 33%

  Anne Magles Stud - Full Video

  4 years ago

  Uporniaswedishvintage

• 08:00 thumb_up 40%

  Cory Chase And Jonathan Jordan - In Cheating Wife Loves Bbc

  4 years ago

  PornTopBBC

• 25:49

  Lrgpnx (160)

  4 years ago

  Uporniacreampie

• 1:07:47 thumb_up 87%

  Beautiful japanese nurse gets fucked hard by the doctor

  4 years ago

  xHamsterdoctornursejapanese uncensoredcreampieasian

• 32:36 thumb_up 88%

  Creaming My Girlfriend’s Stepmom - Jennifer White

  4 years ago

  Uporniastepmomfantasyhairy

• 38:17 thumb_up 69%

  My Horny Japanese Grandma - (episode #03)

  4 years ago

  Uporniajapanese uncensored

• 18:48 thumb_up 62%

  Horny Nuns Cut Loose And Have A Crazy Anal Orgy In Church

  4 years ago

  Uporniaswedishnunorgy

• 07:59

  Rita Daniels 63 Does Hot Porn Video

  4 years ago

  InPornhairy creampie

• 07:58 thumb_up 57%

  60 Yr Grandmother Isogai Kimiko

  4 years ago

  InPorncougar

• 08:19 thumb_up 91%

  Romantic Ass Fuck! It Does Exist! L Stepdaddys Luder

  4 years ago

  UporniaBBWhairyanal

• 05:56 thumb_up 63%

  Daddys Luder - Mein Erstes Mal Schlammschieben! L

  4 years ago

  HClipsgerman

• 40:12

  Gets Pounded By A Teenage Fucker - Ryan Keely

  4 years ago

  TXXXcreampiestockings

• 23:58

  Brandi Love

  4 years ago

  TXXXcougar

• 07:59

  Jav Slut Kaori Buki Loves A Good Gangbang

  4 years ago

  InPornjapanese uncensored

• 20:58

  Getting Laid In Onsen Uncensored

  4 years ago

  TXXXjapanese uncensored

• 02:31

  Bitte nicht schwanger machen - spritz nicht rein

  5 years ago

  xHamstercreampiegerman

• 08:43

  Squirting women, Monika

  5 years ago

  xHamstersquirtbukkakedouble penetration

• 09:13 thumb_up 74%

  Her vagina is the hottest and tightest! dicking down tastey liv!

  5 years ago

  HogTVhomemadebeautycreampieasianhairystepmompussy

• 26:56 thumb_up 79%

  Eva Lovia - Porn Movie Parody About Football And Fans

  5 years ago

  HDZogMILFdeepthroatparodycreampie

• 06:24 thumb_up 80%

  I’m a BBC slut, triple penetration

  5 years ago

  xHamsterdouble penetration

• 08:00

  Bbw Milf Katrin Porto Fucked Dressed As A To Get Hairy Creampie! 21 Min

  1 year ago

  ManySexcreampiestockingshairydress

• 22:56 thumb_up 80%

  Horny doctor makes a hot babe happy

  7 years ago

  DrTubercreampiedoctor

• 07:59

  Big Tits Big Ass All Natural Hairy Pussy Mature Milf Rides Big Black Cock Bbc Anal For Cum And Orgasm After Masturbation

  7 months ago

  uAnalorgasmhomemade

• 58:51 thumb_up 72%

  050211-686-carib JAV Uncensored

  5 years ago

  TXXXjapanese uncensoredhairy

• 29:09 thumb_up 67%

  Smoking hot blonde in black stockings and garter belt is getting her daily dose of threesome

  5 years ago

  Uporniasmokinglingerie

• 16:46 thumb_up 85%

  My Hairy Creampie - Klarisa Leone Porn

  5 years ago

  XoZillablackcreampiepiercingBBC

• 16:56

  Ebony Bbw Part #2 HUGE Titted Mature MOMMY MILF Mistress Thursday Cock Edging, Orgasm Denial & Post Orgasm & Cumming On Her HAIR

  2 years ago

  TheyAreHugefemdom

• 08:44 thumb_up 70%

  Stunning Hairy Blonde Mature Babe Rides The Cock Of Her Horny Boytoy

  3 years ago

  TXXXcreampie

• 08:12 thumb_up 56%

  Multi-orgasmic BBW Gets Hairy Creampie

  1 year ago

  xHamsterstockingsBBWamateurcreampieorgasmredhead

• 50:32 thumb_up 75%

  CREAMPIE HAIRY PUSSY MATURE COUGAR GRANNY FROM JAPAN - AMATEURS - HOMEMADE HOMESEX

  2 years ago

  xHamstermomcreampieGILFhairy

• 05:11

  Hairy Mature Wife Lets Me Creampie Her in Front of the Fireplace

  1 week ago

  $$ FapHouseamateurmissionary

• 02:37

  Creampie with Andy

  1 week ago

  $$ FapHousecouple

• 07:59

  New Milk Makes Better Cream (06-03-2026) Hardcore Milf Roleplay Family Creampie Iluvy

  1 week ago

  PornTophardcorehairycreampie

• 05:15

  My butt nailed rock-hard and creampied

  5 days ago

  VideoSectionass to mouthhairy

• 07:56

  Her nice mature Hairy Pussy is filled with jizz - full sequence - enjoy cum inside

  6 days ago

  HogTVmaturecreampie

• 36:00

  Japanese Mature Step-Mom wake up by Virgin Step-Son

  4 weeks ago

  NuVidcreampiejapanese momstepmommature

• 06:30

  Chubby mature Christina Santes gets fucked good and proper

  2 weeks ago

  MilfFoxhairymaturemature analcreampie

• 18:35

  A Juicy Creampie

  3 weeks ago

  $$ FapHouseMILFsolohairycreampie

• 09:46

  Milf pov, huge cumshot, pussyjob

  2 weeks ago

  XXXVoguehairyhandjobPOV

• 24:25

  Perv Milfs And Teens featuring Sarah Vandella and Tarra Whites martin es xxx

  2 weeks ago

  PornHathairylingerielesbianhandjobpantyhose

• 05:06 thumb_up 88%

  Compilation Of Bbw Milf Creampies In Missionary Position. Amateur Wife

  2 months ago

  HClipscreampie compilationwifecompilation

• 16:47

  Married MILF was cheat on her husband with lover and ask him creampie her hairy

  1 month ago

  Beeghairycreampiecouple

• 43:45

  Johntronx - Lovely Young Thai Amateur Gives Me Her Pussy to Fuck and Creampie

  1 month ago

  $$ FapHousecreampiehomemadeamateurthaiasian

• 05:00

  Stepmom Kat Marie Lets Jodie Suck Her Tits, Then Gets Stuffed & Creampied By Tutor Ralph

  1 month ago

  Fuxxxstepmom

• 08:00

  Milf Bbc Creampie Sex With Charming Helena Price And Jonathan Jordan From

  1 month ago

  ooXXXhairyinterracialfetish

• 06:20 thumb_up 50%

  Jackie Hoff, Hayley Davies And Von Doom In Enjoy A Stepfamily Creampie Compilation

  3 months ago

  Fuxxxcreampie compilationcompilation

• 30:01

  Japanese Teenie at Creampie Love making

  2 months ago

  XoZillateen anal (18+)maturefull movieanal

• 07:59

  Busty Hairy Asian With Big Natural Titties In Hardcore Action With Cumshot - Starring Yukimi Chinatsu

  2 months ago

  xMILFnatural

• 08:16

  Hairy French Amateur Cuckold Wife Lets Me Cum Inside Her Pussy

  2 months ago

  $$ FapHousestepmomfrenchcreampiehairywife

• 08:08

  Mature Goddess Miu Suzuha Delivers Sensual Outdoor Blowjob Experience

  2 months ago

  HogTVjapanesejapanese mommomjapanese uncensored

• 11:06

  Petite Japanese Cougar Gets Hairy Pussy Creampie

  4 months ago

  HClipshairycreampiemature

• 1:46:31

  Nikki Hunter and Cadence Luxs hd trailer by Perv Milfs And Teens

  3 months ago

  PornHatcreampielesbianhairyass licking

• 08:00

  Tattooed Young Asian Milf Gets Creampied

  4 months ago

  ManySexthai

• 08:00

  3x Humble Hairy Japanese

  3 months ago

  ManySexjapanese uncensoredhairyjapanesecreampie

• 11:34

  Sultry bang-out of Real duo, Lots of Long Kisses with Creampie Ending

  3 months ago

  HDSexcouplehairyhomemadeamateur

• 07:59

  Fukumoto Is A Granny Looking For A Cock To Cum

  5 months ago

  InPornstockings

• 08:00

  Asian Milf Lets Bf Pinch Her Lactating Tits & Drill Her Muff While Shes On The Phone With Her Hubby

  5 months ago

  InPornhairyjapanese uncensoredlactating

• 07:59

  Skinny Blonde With Pierced Hairy Clit Has Anal Fuck With Cum Facial

  5 months ago

  xMILFfacial

• 05:51

  Milky Mari In Femdom Bbw Stepmommy Ride My Cock Until I Cum Inside Her Fertile Hairy Pussy And Make Her Pregnant!

  4 months ago

  PePornpregnantfemdomBDSM

• 07:59

  A Shower A Bath, A Blowjob And A Good Bed Fuck For The Asian Mature Lady Nobuko Tachikawa

  4 months ago

  ManySexhairyjapanese uncensored

• 13:02 thumb_up 69%

  The Red-haired Secretary Pounced On The Dick And Got A Creampie From The Boss

  6 months ago

  TheyAreHugecreampiePOVrussianredheadridingsecretary

• 14:21 thumb_up 50%

  Very sexy horny hairy wife: Milf, Cumshot Big Dick Porn

  5 months ago

  JizzBunkerlesbianhairycreampie compilationcumshotvintagehandjob compilationcumshot compilation

• 10:03 thumb_up 88%

  I poke a horny woman and cum inside her furry beaver. Close-up of her hairy pussy.

  5 months ago

  VideoSectionhomemadecreampiechubbyBBWmissionaryclose up

• 14:58 thumb_up 63%

  Wife gets fucked by black stud and creampied in home cuckold

  5 months ago

  LetsPornmatureblackcreampieinterracialwifehairycuckold

• 07:31

  Dark-haired Ukrainian MILF gets her hairy cunt drilled after sucking BBC

  5 months ago

  DefineBabeBBCPOV

• 28:03

  Well-proportioned ladyloves asian creampie dirt

  6 months ago

  PornHatanaljapanesebig cockkorean

• 05:35

  MILF Aaliyah Love seduces her sons young friend

  6 months ago

  MegaTubeseducedhairy

• 12:05 thumb_up 67%

  Unleashing the wild fantasies of a voluptuous Asian MILF in JAV porn.

  6 months ago

  HogTVjapanese uncensoredcreampiehairy

• 07:59

  4 Perfekte Orgasmen! Ungeschnitten-heulattacke-doppelsquirt-arschfick-creampie!!! L Stepdaddys Luder

  6 months ago

  uAnalsquirt

• 07:14 thumb_up 80%

  Amateur Milf Creampie Compilation Close-up. Homemade Videos

  6 months ago

  HClipslatinaBBWcompilation

• 21:44 thumb_up 75%

  Watch Granny Sandora gets massive cream into her hairy cunt - Doggy, Hairy, Granny Porn

  8 months ago

  JizzBunkerhairygrannyvintagecreampie

• 29:48 thumb_up 40%

  Phat melon Stepmom Lets Me creampie Her Tight Butthole on Xmas - Mypervyfamily

  7 months ago

  MatureClubasscouplecreampiehairy

• 08:00

  Blonde Milf Fucked Hard - Raw Sex With Big Dick & Facial With Blake Blossom

  8 months ago

  KePornmissionaryhairy

• 08:17

  Anal creampie reward for lustful brunette in stockings

  7 months ago

  PornLibstockings

• 05:35

  Juicy Juicey Janey gets fucked and creampied

  7 months ago

  MegaTubebrunettehairynaturalmasturbation

• 10:30 thumb_up 60%

  Sexy Big Tit Milf Gets Railed By 11 Min - Harry Long007, Young Bull And Maddie Cross

  9 months ago

  HClipscreampieinterracialmatureBBWhairy

• 07:11 thumb_up 78%

  Her lovely mature Hairy Pussy is packed with cum - enjoy cum inside

  8 months ago

  Sexucreampiehairy

• 10:21 thumb_up 72%

  Full cum shots in my hairy pussy while my husband is busy, real cuckold experience

  9 months ago

  XXXVogueindiancreampiecuckoldcreampie compilationass to mouthstepmomcompilation

• 05:59

  Japanese Milf Ayana Has An Affair And Gets A Asian Creampie

  8 months ago

  TXXXlatexcreampiebrazilasianhairyjapanesenipples

• 08:00 thumb_up 80%

  Home Of Some Of The Worlds Nastiest Grannies

  8 months ago

  KePorngranny

• 07:04

  Milky Mari In No-condom Impregnation Sex In Missionary Position With A Very Hairy Milf Wife

  9 months ago

  KePorncondom

• 20:25 thumb_up 50%

  Creampie Hairy MILF Stepmom After Her Disappointing Date

  9 months ago

  $$ FapHousebritishhairyamateurstepmomMILFnatural

• 08:00 thumb_up 74%

  New My Whore Stepmom Wants My Cum 2025 Creampie Bigass Asian Interracial Roleplay Stepmom Hardcore Demoninc

  9 months ago

  PornTopwhorebig titsstockingsfantasy

• 05:04

  Bbw Milf Mummy Missionary Creampie

  9 months ago

  KePornbritish

• 08:00

  Nymphomaniac Japanese Small Tits Wife Seduce To Cheating Creampie Fuck While Husband Is Next Door

  9 months ago

  Fuxxxwifejapanese uncensoredhairyhusbandasianjapanese mom

• 16:10 thumb_up 71%

  Curvy Mature With Hairy Pussy Enjoys Hot Sex

  11 months ago

  xHandmaturechubbyhairycreampieass lickinghandjob

• 07:00

  Lucky Young Guy Gets To Fuck Perfect MILF Maki Hojo - JapanHDV

  10 months ago

  TXXXjapanese uncensored

• 43:18

  Chinese beautiful girl with big breasts CHINESEG face showing goddess and blowjob is so comfortable SWAG hot model beauty with a hairy shower head at home and finds her master to repair it and seduces him passionate Mandarin dialogue in the bathroom

  10 months ago

  JizzBunkercreampiechinesehairy

• 10:36

  My sexy mature mom in assorted cumshot scenes

  10 months ago

  XXXVoguehandjobamateurindiansmall cockcreampiecuckoldcreampie compilation

• 07:05

  Hairy pussy milf gets it in the ass while standing up

  10 months ago

  XXXVoguecreampiehairy

• 08:00

  Very Beautiful Granny Anal Creampie Bbc

  1 year ago

  ManySexbeautymature analanalbig cocktoysgranny anal

• 08:00 thumb_up 78%

  Japanese Lactating Milf Squirting

  1 year ago

  Fuxxxhairyjapanese uncensoredlactating

• 31:16

  Uncensored JAV Creampie Sex for Japanese Step-Mom

  1 year ago

  VipTubehairyjapanese uncensoredasianstepmomjapanese momfingering

• 10:05 thumb_up 80%

  Big Pussy - I Fuck My Hot Stepmom. Big Hairy Pussy Close-up Creampie

  11 months ago

  HClipsclose uphairycouplecreampieamateur

• 09:54 thumb_up 85%

  Mature woman loves a feeling of a hot cum inside

  11 months ago

  MyLustmaturecreampiewifecouple

Categories

Other free porn sites