Mature • French Hd 6,746 videos

• 43:42 thumb_up 81%

  French Slut 1

  3 years ago

  HClipsamateurstockingsfrenchanalbig assthreesomeinterracial

• 30:43 thumb_up 83%

  Big Tits MILF Mommy Anal in France

  1 month ago

  XXXDanfrenchmomanalMILFbig titshardcore

• 30:03 thumb_up 88%

  Son cum inside his stepmom because of cheating dad

  2 years ago

  PornDramateurfrenchcreampiewifeMILFcheatingstepmom

• 28:44 thumb_up 82%

  Husband Pounds Busty French Matures Natural Big Tits

  1 week ago

  JizzBunkerfrenchmaturebig titsamateur

• 40:23 thumb_up 78%

  Clia and Sheinas French FFM Threesome with Intense Dirty Fucking

  2 weeks ago

  JizzBunkerthreesomefrenchFFM

• 19:01 thumb_up 68%

  Mates- Gig #05

  1 week ago

  PornDrhandjobfrenchcreampieanalgrannywifetattoo

• 40:48 thumb_up 66%

  French Mature Amateur Couples Homemade Sex and Cum

  1 month ago

  XXXDanfrenchmaturehomemadeamateurcouple

• 35:33 thumb_up 74%

  Shy French Amateur Mature Tries Double Penetration Casting

  2 weeks ago

  XXXDanthreesomematurefrenchcastingdouble penetrationshyamateur

• 31:14 thumb_up 73%

  French Mature Slut Gets Wrecked

  6 days ago

  JizzBunkeramateurmaturefrench

• 18:44 thumb_up 91%

  French Emmanuelle Worley Takes Big Cock Anal in Silence

  4 days ago

  XXXDanfrenchamateuranal

• 32:27 thumb_up 77%

  Young French Guys Hookup with Beauty for Threesome Fuck

  2 months ago

  JizzBunkercumshotmatureold and young (18+)frenchthreesomebeauty

• 40:19 thumb_up 76%

  Marie french mature big lips pussy hard fucked by two guys. double penetration

  4 weeks ago

  JizzBunkerthreesomefrenchdouble penetrationmature

• 27:58 thumb_up 80%

  Old blonde German slut getting her amazing tits sprayed with cum

  3 years ago

  xHamstermatureamateurhomemadefrenchblowjobgermangranny

• 54:12 thumb_up 81%

  100% Reel anal: I transformed my little French granny into an anal slave..

  2 years ago

  xHamstermaturemomhomemadefrenchmature analanalsquirt

• 32:36 thumb_up 79%

  Young Toy Boy Pounds French Matures Anal

  2 weeks ago

  JizzBunkermaturefrenchanalmature anal

• 32:08 thumb_up 80%

  French Grannys Anal POV

  1 week ago

  JizzBunkerPOVfrenchgrannygranny analanal

• 17:22 thumb_up 65%

  Divorced Step Mom With Step Son At Home - Afternoon Hardsex

  4 years ago

  HDZogmatureamateurmomteen (18+)frenchbig assstepmom

• 34:26 thumb_up 73%

  Dorian Pounds Young French Mature Isabella Hard

  1 week ago

  JizzBunkermaturefrench

• 46:31 thumb_up 69%

  French Mature Isabelle & Debbie Anal - Isabelle Ferreira

  4 years ago

  TXXXamateurstockingsfrenchlesbianmature analthreesomegranny

• 24:01 thumb_up 82%

  SPECTACULAR ! Real Stepmom fucks her Stepson while her husband works -

  5 days ago

  HogTVfrenchamateurMILFblowjoborgasmhusbandfantasy

• 28:27 thumb_up 79%

  Nina Nice French MILF Craves Harder Sex Scene

  1 week ago

  XXXDanmaturefrenchMILFslut

• 39:13 thumb_up 80%

  French MILF Marie Galant Takes Gardeners Anal Pounding

  1 month ago

  JizzBunkerfrenchanalMILFmature analmature

• 30:39 thumb_up 77%

  Marion Moon with big tits gets her ass stretched in anal sex

  4 years ago

  xHamstermaturemomstockingsfrenchmature analanalgranny

• 29:49 thumb_up 73%

  The 55 year old mature does her ganbang

  2 years ago

  xHamstermatureamateurmomhomemadefrenchmature analanal

• 37:03 thumb_up 68%

  French MILF Sucks Off Son

  1 week ago

  XXXDanfrenchMILF

• 41:18 thumb_up 85%

  French Young Amateur Mature in FFM Threesome

  6 days ago

  JizzBunkeramateurfrenchmatureFFMthreesome

• 26:07 thumb_up 84%

  Cock in the ass and intensive squirting at the beach

  2 years ago

  xHamsterfrenchspanishbeachanalsquirtoutdoorMILF

• 18:45 thumb_up 85%

  Happyvids33s Tantric Double Penetration Back Rub

  2 weeks ago

  XXXDanmassagefrenchamateurmatureMILFdouble penetration

• 20:43 thumb_up 83%

  Amateur - my stepson fuck me so hard in my ass and make me squirt

  2 years ago

  xHamsteramateurhomemadefrenchPOVanalsquirtcheating

• 38:57 thumb_up 85%

  Ffm Fist Shagging Initiation Of A Busty brunette

  5 years ago

  Analdinamateurcutefrenchthreesomefistingnipplesriding

• 36:15 thumb_up 88%

  The mature French woman wants two big cocks just for her

  2 years ago

  xHamsteramateurmomhomemadebeautyfrenchmature analgranny

• 48:17 thumb_up 83%

  Mature french woman gets her first anal

  6 years ago

  TXXXmaturefrenchmature analfacialanal

• 36:30 thumb_up 77%

  French MILF Adle Gets Pounded by European BWC

  2 months ago

  XXXDanmaturefrenchslutMILF

• 38:53 thumb_up 73%

  Beauty soul mate - bubble butt porn - Mature NL

  3 years ago

  OkXXXamateurmombeautyfrenchlesbianPOVbig ass

• 27:34 thumb_up 72%

  So Pretty Mom Real Estate Agent

  5 years ago

  Analdinmomcutefrenchnipplesridingbabeerotic

• 39:16 thumb_up 64%

  34Yo French Matures FFM Threesome with Young Stella and Clara

  1 week ago

  XXXDanFFMfrenchmaturethreesome

• 38:06 thumb_up 73%

  French MILF Sonia at 50 Year Old Slut in Sex Video

  2 weeks ago

  JizzBunkermaturefrench

• 31:57 thumb_up 75%

  French Mature Mia Smoke Fucked Hard and Deep

  1 week ago

  JizzBunkermaturefrenchsmoking

• 24:55 thumb_up 72%

  Wife Enjoys Two Big Cocks, Double Cumshot on Face

  1 week ago

  HogTVridingamateurfrenchcreampiedouble penetrationwifethreesome

• 36:09 thumb_up 74%

  French Blonde MILF Pounded in Video Club

  2 weeks ago

  XXXDanfrenchmaturevintageclub

• 43:19 thumb_up 89%

  Shy French divorced teacher

  7 years ago

  TXXXamateurfrenchdoggingshyteacherdeepthroat

• 1:32:34 thumb_up 82%

  Liaisons coupables (1987, Sandra Morin, full video, DVD)

  5 years ago

  xHamsterfrenchvintagefull moviehardcorehairy

• 29:26 thumb_up 81%

  French School Teacher Beatrice Secretly Loves Taking a Big Cock Up Her Ass

  1 year ago

  xHamstersmall cockfrenchblowjobmature analanalbig assMILF

• 1:18:19 thumb_up 86%

  Catherine Ringer, French Classic And Cathy Stewart In French Vintage Provinciales En Chaleur 1981

  4 years ago

  TXXXfrenchclassicvintage

• 16:11 thumb_up 70%

  Leo Price Joys Janet Masons Poon

  2 months ago

  PornDrhandjobbeautyfrenchblowjobPOVwifebig tits

• 31:26 thumb_up 54%

  Eva Strangers Tattooed French Seduction in First Casting

  1 week ago

  XXXDanamateurfrenchcastingmature

• 1:01:38 thumb_up 79%

  French wife offered to a stranger at the hotel

  5 years ago

  xHamsterfrenchswingermature analthreesomewifedouble analhotel

• 35:01 thumb_up 78%

  Big Boobed Mommy Gets Sodomized

  5 years ago

  Analdincutefrenchanalnipplesbabeerotic

• 1:31:11 thumb_up 78%

  Anal Clinic (1993, France, full video, Julia Channel, 2k)

  4 years ago

  xHamsterfrenchclassicfull moviehairyvintageanal

• 23:18 thumb_up 75%

  Un film de fou

  5 years ago

  xHamsterhandjobmaturemomfrenchmature analanalcougar

• 1:14:13 thumb_up 81%

  3 Cougars French Milf Gilf Milf French

  2 years ago

  HClipsamateurstockingsfrenchmature analanalthreesometattoo

• 40:38 thumb_up 81%

  Nathalies Big French Ass Pounded Hard by Young Stud

  3 weeks ago

  XXXDanfrenchanalmature analmature

• 42:49 thumb_up 85%

  Mature NL - cow girl clip

  2 months ago

  PornHatmaturemomstockingspublicfrenchblowjobmature anal

• 36:41 thumb_up 83%

  Young Cock Pounds French Amateur Mature Woman

  1 month ago

  XXXDanamateurfrenchmature

• 32:09 thumb_up 80%

  French Mature Tries Double Penetration with Two Cocks

  1 month ago

  XXXDanthreesomematurefrenchamateurdouble penetration

• 35:11 thumb_up 76%

  Samantha French Takes Young Fist for Her First Anal Casting

  2 months ago

  JizzBunkercastingmatureamateurfrenchmature analfistinganal

• 36:09 thumb_up 81%

  A 30 Yo Blond Hair Lady Gets Pounded In A Paris

  5 years ago

  AnaldinhandjobcutefrenchMILFnipplesbabeerotic

• 37:24 thumb_up 83%

  Two BBCs Pound Hot French MILF Marie Lucamaria

  6 days ago

  XXXDanmaturefrenchMILFinterracialBBCthreesome

• 25:29 thumb_up 78%

  Prend MOI direct sur la table

  6 years ago

  xHamsterfrenchauditionsecretaryspankingMILF

• 54:48 thumb_up 85%

  On A Retrouve Ta Maman Isabelle

  5 years ago

  Uporniastockingsfrenchanalthreesomeinterracialbig cock

• 45:35 thumb_up 81%

  French J&m Supersized Big Beautiful Woman Sophie 27 Years Old Whore - high-resolution

  7 years ago

  AnaldinbeautyfrenchfistingBBWmasturbationwhoreslut

• 30:41 thumb_up 78%

  Eager French Mature in Sexy Lingerie Takes Lesbian Fisting

  1 month ago

  JizzBunkermaturefrenchlesbianfisting

• 38:11 thumb_up 73%

  Two French Shaved Grannies Ride Young Cock in Threesome

  2 months ago

  XXXDanfrenchgrannythreesomeridingshaving

• 22:56 thumb_up 81%

  Lily young chubby french teen hungry of cock

  1 month ago

  XXXDanmaturechubbyfrenchteen (18+)

• 33:18 thumb_up 85%

  Alex Jsex, riesen Facial nach Anal in der Kueche

  5 years ago

  xHamsterhomemadeteen (18+)frenchmature analanalteen anal (18+)short hair

• 47:36 thumb_up 82%

  Aurelie Casalingue Francaise

  4 years ago

  HClipsmatureamateurstockingsfrenchmature analanalthreesome

• 38:16 thumb_up 85%

  La France A Poil - Jessy, Young Redhead Slut, Gets Her

  6 years ago

  HClipscastingfrenchanalthreesomehairyredheadslut

• 27:40 thumb_up 78%

  The sharp pain in her anus does not prevent her from cumming anally.

  1 week ago

  HogTVbig titsanalmature analfrenchmaturehomemadestepmom

• 37:24 thumb_up 77%

  Hardcore casting for a slutty mature woman

  2 years ago

  xHamstercastingamateurmomhomemadefrenchblowjobmature anal

• 23:04 thumb_up 78%

  Irina Shows a House Around and Gets Fucked

  3 days ago

  Sexucumshotfrenchlingerieamateur

• 37:56 thumb_up 88%

  Chriss pornhjb video

  10 months ago

  PornHatmaturefrenchblowjobmature analanalmassageoil

• 28:55 thumb_up 80%

  A mature woman has her gangbang in the farm next to the goats

  1 year ago

  xHamsterfrenchmature analwifeorgasmgangbangfarmgroup

• 1:42:25 thumb_up 73%

  Escort A Domicile (2018) - Full Movie

  3 years ago

  HDZogstockingsfrenchanalfull movieescortlingerie

• 27:26 thumb_up 67%

  French Milf Penelope Slut Casting

  2 weeks ago

  XXXDanfrenchcasting

• 33:21 thumb_up 79%

  BWC Friend Pounds Stunning French Blonde Chlofit

  2 weeks ago

  XXXDanmaturefrenchbeauty

• 36:18 thumb_up 64%

  Chubby French Matures First Gangbang Cumshot

  5 days ago

  XXXDanmaturefrenchgangbangchubby

• 17:24 thumb_up 77%

  Lina Luxa and Alba: French Young Matures in Threesome

  3 days ago

  JizzBunkermaturefrench

• 18:16 thumb_up 68%

  French Mature Slut Performs Blowjob on Car Wash Guy

  2 weeks ago

  XXXDanfrenchmaturecar

• 15:45 thumb_up 83%

  Mavi Burbujita & Melany Two Sluts Scissor And Finger Each Other

  3 weeks ago

  PornHatorgasmlesbianfrenchhairystrapon

• 34:28 thumb_up 56%

  Young French Matures Massive Natural Tits

  1 week ago

  JizzBunkerfrenchmature

• 33:02 thumb_up 75%

  If you want to bake a cake, you need protein

  4 years ago

  xHamstermomfrenchMILFfacialass to mouthswallowkitchen

• 15:51 thumb_up 68%

  Super-naughty mature gigi enjoys to have fun with her fur covered beaver in the garden cougar sucky-sucky

  3 weeks ago

  PornDrmatureamateurhomemadefrenchvoyeurwifesolo

• 15:42 thumb_up 86%

  Lusty Jenys anal sex

  3 months ago

  PornHatmaturemomfrenchblowjobmature analanalbig ass

• 34:18 thumb_up 77%

  French Young Slut In Black Stockings Has Slut Threesome Dp

  4 years ago

  HDZogfrenchdouble penetrationanalthreesome

• 30:14 thumb_up 88%

  Loona Carole - French Mother And Son

  5 years ago

  TXXXfrenchfantasyMILF

• 34:24 thumb_up 77%

  Skinny french slut Evy Sky fucked in her tight asshole for money

  2 years ago

  xHamsterstockingsfrenchanalmoneyMILFcumshotcougar

• 23:50 thumb_up 82%

  Cute Emy fucked in the ass just after fisting the pussy of her friend Anastasia

  3 years ago

  xHamstercutepublicfrenchcreampielesbianbeachfisting

• 37:19 thumb_up 76%

  Italian Granny

  5 years ago

  xHamsteritalianfrenchgrannywifeBBWdoggingcougar

• 23:14 thumb_up 22%

  Lesbian Milfs Solo Black Lingerie Couch

  6 days ago

  XXXDanlesbianfrenchMILF

• 17:58 thumb_up 75%

  Busty French Swinger Milf Duo

  2 weeks ago

  JizzBunkerfrenchswingerbig titsgroup

• 33:39 thumb_up 56%

  Tom French Pounds BBW Ursina

  1 month ago

  XXXDanchubbyfrenchmatureBBWgrannyold and young (18+)

• 32:57 thumb_up 65%

  Amandine Pellissard, Chat-bite, Charles Vassal And Alice: From Tv To Sex (06.02.2023)

  3 years ago

  HDZogfrenchstockingslatex

• 36:53 thumb_up 76%

  Hot Young French Amateur Lylou Glams Rides Joss BBC

  2 weeks ago

  XXXDanmaturefrenchinterracialamateurBBCriding

• 20:18 thumb_up 79%

  Bob Deker Double Penetrates French Granny on Sex Machine

  1 month ago

  XXXDanpublicfrenchanalthreesomegrannyinterracialdouble anal

• 34:07 thumb_up 33%

  Chlo Chevalier French Amateur Rides Thick BBC

  1 week ago

  JizzBunkerfrenchmatureinterracialamateur

• 25:33 thumb_up 79%

  French Short Hair Swinger Slut Wife BBC Shared by Husband 2

  5 years ago

  xHamsterfrenchcreampieswingerwifecuckoldshort hairhusband

• 35:11 thumb_up 67%

  Double-Penetration MMF with French Amateur Mature Slut

  2 weeks ago

  JizzBunkerfrenchdouble penetrationMMFamateurmaturethreesome

• 1:17:36 thumb_up 70%

  Famous Classic Porn Movie With Beautiful Young Ladies

  2 years ago

  HDZogstockingsanalclassicdeepthroatvintagefrench

• 18:57 thumb_up 68%

  BBW French Maid fucks married neighbour

  4 years ago

  xHamsterfrenchBBWmaidbritishswallowmissionaryPAWG

• 32:06 thumb_up 57%

  Alice Maze and Two French Matures in Hot Lesbian Fisting Foursome

  1 week ago

  XXXDanlesbianfrench

• 40:26 thumb_up 60%

  Chubby Brunette Matures Endure Anal DP in Foursome

  4 days ago

  XXXDanmatureanalfrenchmature analchubbydouble penetrationslut

• 15:07 thumb_up 61%

  Compilation of what you'll find on my private platforms, Dazzlingfacegirl

  1 year ago

  xHamsterpissinghomemadefrenchcreampie compilationcompilationswallowslut

• 25:39 thumb_up 67%

  French Mature Andrea Craves Fucking in Third Casting

  1 week ago

  XXXDanfrenchmaturecasting

• 26:54 thumb_up 74%

  Small Homemade Sodomy Compilation

  2 years ago

  xHamstermomhomemadefrenchcreampiemature analanaldildo

• 38:59 thumb_up 68%

  French MILF Sucks Cock

  1 month ago

  XXXDanfrench

• 38:14 thumb_up 81%

  Skinny french MILF getting fucked in the ass

  3 years ago

  xHamstermaturefrenchMILFskinny

• 17:31 thumb_up 83%

  Kinky thick mega-slut Brenda got ravaged again

  9 months ago

  PornDrhandjobbeautysmall cockfrenchwifemasturbationbig cock

• 25:45 thumb_up 79%

  Cheyenne Duvallon Chubby French Milf Teacher

  1 month ago

  JizzBunkermaturefrenchchubbyBBWteacherslut

• 22:10 thumb_up 67%

  Beautiful curvy french amateur Milf does an amazing anal casting

  4 years ago

  xHamstercastingbeautyfrenchfirst timeanal

• 33:12 thumb_up 84%

  French Greek Teacher Dp Gang Bang Fantasy

  4 years ago

  TXXXamateurstockingsfrenchgreekPOVsquirtfisting

• 34:25 thumb_up 80%

  Young French Cute Roleplay with Mikess Ends in Hardcore Cumshot

  1 month ago

  XXXDanlingeriefrenchcuteMILFhardcore

• 38:31 thumb_up 69%

  French Granny Olivia Del Rio Rides Cock

  3 months ago

  XXXDanmatureamateurfrenchmature analanalgrannyfetish

• 16:46 thumb_up 83%

  Je film ma femme et son amant et je me joint a eux pour un bon trio

  7 years ago

  HDZogfrenchmasturbationamateurmature

• 24:46 thumb_up 80%

  Hot brunette MILF from Germany riding a loaded BBC

  3 years ago

  xHamsteramateuranalBBCinterracialvintagefrench

• 48:28 thumb_up 78%

  Ejacs Compil 12

  5 years ago

  HDZogstockingsfrenchMILFfacialbukkakecompilationgroup

• 38:25 thumb_up 67%

  French Mature Lesbians in Hot FFM Threesome

  1 week ago

  XXXDanthreesomelesbianfrenchmatureFFM

• 39:00 thumb_up 78%

  Horny French Mature Olivia Craves Young Cock to Pound Her

  1 month ago

  JizzBunkeramateurfrenchmatureslut

• 36:55 thumb_up 60%

  Young French Mature Amateurs First Casting with Double Penetration

  2 weeks ago

  XXXDanfrenchcastingdouble penetration

• 41:19

  Couple bedroom intimate POV

  1 week ago

  PornHatanalfrenchamateurPOVblowjobpussy

• 39:36 thumb_up 79%

  Repman Pounds French Mature Cla

  1 month ago

  XXXDanmaturefrenchslut

Categories

Other free porn sites