Mature • French Creampie 1,027 videos

• 23:12 thumb_up 63%

  Stepmom confesses that she fucks her family and then fucks her stepson Brianna Beach.M

  4 years ago

  XXXDanamateurpublicfrenchcreampielesbiangermanbeach

• 43:06 thumb_up 79%

  Alluring french GILF crazy adult scene

  5 years ago

  Analdinamateurfrenchcreampieanalsquirtthreesomegranny

• 44:38 thumb_up 77%

  French Cuck Hubby Helps Black Man Fuck His Wife

  5 years ago

  xHamsteramateurblackfrenchcreampieinterracialwifecuckold

• 17:12 thumb_up 67%

  He accidentally filled his stepsister with cum! - Eva Alfie

  2 years ago

  XXXDanamateurpublicfrenchcreampielesbiangermananal

• 19:01 thumb_up 68%

  Mates- Gig #05

  1 week ago

  PornDrhandjobfrenchcreampieanalgrannywifetattoo

• 23:50 thumb_up 82%

  Cute Emy fucked in the ass just after fisting the pussy of her friend Anastasia

  3 years ago

  xHamstercutepublicfrenchcreampielesbianbeachfisting

• 40:16 thumb_up 67%

  A Back-to-college Gangbang, We Get Fucked Like Bitches and Empty Every Cock That’s There

  2 weeks ago

  $$ FapHousebukkakefrenchgangbangamateurcreampiecollege

• 15:51 thumb_up 68%

  Super-naughty mature gigi enjoys to have fun with her fur covered beaver in the garden cougar sucky-sucky

  3 weeks ago

  PornDrmatureamateurhomemadefrenchvoyeurwifesolo

• 15:29 thumb_up 88%

  MOMMYS BOY - MILF Siri Dahl Caught Naked In The Kitchen! Stepson Banged Her Hard! FRENCH SUBTITLES

  8 months ago

  SexPlexmomfrenchcreampiespanishcaughtasskitchen

• 40:41 thumb_up 80%

  Julie Holly First She Sucks Then Takes It In The Ass – Creampie Finish

  2 weeks ago

  PornHatfrenchblowjobcreampiebig asshairyshort hairriding

• 35:15 thumb_up 70%

  Big-Bosomed French Girl Get Banged In The Wood

  4 years ago

  XoZillafrenchswingerwifeoutdoorstudentfistingbondage

• 15:07 thumb_up 61%

  Compilation of what you'll find on my private platforms, Dazzlingfacegirl

  1 year ago

  xHamsterpissinghomemadefrenchcreampie compilationcompilationswallowslut

• 17:05 thumb_up 61%

  Beautiful teen latina with big ass gets fucked amazingly, she loves riding cock

  2 years ago

  XXXDanbeautypublicteen (18+)creampiemassageasianteen anal (18+)

• 26:54 thumb_up 74%

  Small Homemade Sodomy Compilation

  2 years ago

  xHamstermomhomemadefrenchcreampiemature analanaldildo

• 25:33 thumb_up 79%

  French Short Hair Swinger Slut Wife BBC Shared by Husband 2

  5 years ago

  xHamsterfrenchcreampieswingerwifecuckoldshort hairhusband

• 31:51 thumb_up 64%

  I fucked a random guy over the weekend in Paris and let him cum on me - Eva Elfi

  2 years ago

  JizzBunkercreampiegermanasianjapaneseBBWBDSMcelebrity

• 27:24 thumb_up 71%

  I fuck a bit in french

  1 week ago

  HDZogbabefrench

• 25:18 thumb_up 77%

  Big Butt Stepmom in Fishnets Cheats With Creampie

  1 month ago

  XXXDanmatureamateurfrenchcreampiebig asscheatingstepmom

• 19:51 thumb_up 77%

  PAINFUL ANAL! Crying & Screaming for an unwanted Creampie in Ass Anal - EXTREME & ROUGH ANAL

  4 years ago

  xHamsteramateurfrenchmature analassscreaminganal

• 19:14 thumb_up 78%

  See PLUMPER Grandma lovin’ some young lollipop

  2 weeks ago

  PornDrgrannyfrenchhandjobcreampie

• 18:16 thumb_up 70%

  50 Year Old Blonde Cougar, Stunning Mature French Bitch Ass.

  9 months ago

  $$ FapHousefrenchmature analanalbig assdoggingblondecougar

• 50:48 thumb_up 89%

  Lustful 40 y.o. MILF gangbang hardcore adult scene

  5 years ago

  Analdinfrenchcreampiesquirtorgasmgangbangbabe

• 34:52 thumb_up 80%

  Buxom Cougar Thanks Sonnies Mate By Getting His Stiffy Humid - Melony Bra-stuffers

  4 weeks ago

  PornDrhandjobfrenchblowjobbig titsbig cockcougar

• 1:03:28 thumb_up 77%

  Beurette Gangbang - Anima

  4 years ago

  TXXXfrencharabbukkakegangbangcreampieinterracial

• 16:49 thumb_up 83%

  While driving my jsister erks my cock to make me hard

  4 years ago

  xHamsterhomemadefrenchblowjoboutdoorflashingcarswallow

• 16:13 thumb_up 82%

  Femme mature mariée trompe son mari a l hotel

  2 years ago

  TXXXamateurfrenchcreampiecouplewifehotel

• 15:45 thumb_up 88%

  Chubby spic mommy filthy xxx clip

  1 year ago

  XoZillahomemadefrencharabchubbyBDSM

• 16:44 thumb_up 81%

  Fuck and cum inside mouth creampie pussy whore stepmom big boob share in pov this slut milf multiple cum on stepmother b

  3 years ago

  xHamsterfrenchtieddeepthroatwhorecum in mouthcum on pussy

• 16:22

  Mummy Talks a Married Couple Into harsh threeway

  1 week ago

  HDSexmasturbationfrenchass to mouthcum in mouthBDSM

• 35:30 thumb_up 76%

  Stepmother Explains To Her Stepson - Full Anal Creampie - Hot - English Subtitle

  3 weeks ago

  Sexumaturefrenchamateurmature analanalstepmom

• 15:07 thumb_up 64%

  Horny natural french whore with big tits taking a big white Cock ,multiple orgasm

  6 years ago

  xTitsteen (18+)frenchcreampiesmokinginstructionteen anal (18+)funny

• 25:18 thumb_up 84%

  Visit From my Big Ass Stepmother in Fishnets - Amateur hardcore with Creampie cumshot

  1 year ago

  xTitspantyhosefrenchblowjobcreampielingeriestepmomnatural

• 17:14 thumb_up 60%

  Deutsche grannie - Sequence #02

  1 week ago

  PornDrmasturbationgrannyfrenchcreampiegerman

• 27:11 thumb_up 66%

  New Years resolutions from stepmom and son

  4 years ago

  JizzBunkerpublicfrenchcreampieanalmassageinterracialBDSM

• 34:41 thumb_up 89%

  Mugur and Julie Hollys titty fuck dirt by Mature NL

  1 year ago

  PornHatfrenchmature analanalshort hairass lickingasscum in mouth

• 19:16 thumb_up 86%

  Gorgeous French MILF horny adult scene

  9 months ago

  XoZillacum in mouthdouble analfrench

• 37:43 thumb_up 60%

  Cheating French Cougar Rides Thick BBC

  2 months ago

  JizzBunkercuckoldfrenchcougarcreampieBBC

• 21:36 thumb_up 63%

  Hot Stranger lost in the woods, I fuck her pussy while she doesnt notice, pretending to help her

  2 years ago

  JizzBunkerfrenchcreampieanaloutdoorjapanesecelebritystranger

• 21:35 thumb_up 88%

  A sex education lesson that ends in Anal Creampie - Best French Stepmom - JULIEHOTMOM

  3 years ago

  inXXXfrenchanalcreampie

• 27:00 thumb_up 69%

  The adoptive family shares a bed in the hotel room! Stepmoms first threesome

  2 years ago

  XXXDanjapanese lesbianjapanese massagelesbiancelebritypublichotel

• 40:44 thumb_up 84%

  Fabienne & Steffy Anal Gyno

  4 years ago

  Uporniafrenchmature analfistinggynocougargranny anal

• 30:08 thumb_up 50%

  The stepson entered her ass too abruptly...

  2 weeks ago

  HogTVhomemadefrenchcreampieanal18stepmom

• 24:08 thumb_up 80%

  Fine French poking

  2 weeks ago

  PornDrmaturehomemadefrenchblowjobwifelingeriereality

• 58:36 thumb_up 76%

  2 serious French matures sodomized fisted facialized at the gynecologist

  4 years ago

  JizzBunkerfistingcreampie compilationcumshot compilationfrenchcreampiemature anal

• 40:02 thumb_up 84%

  Double trouble for that ass

  7 years ago

  BeegfrenchMMFdouble penetration

• 17:42 thumb_up 78%

  Handsome Cougar Gigi Dior Anything For Her Have The Hottest Dads Day

  3 weeks ago

  PornDrhandjobfrenchblowjobinterracialwifemasturbationbig cock

• 25:24 thumb_up 80%

  French MILF Marina Beaulieu heart-stopping IR adult movie

  3 years ago

  Analdinfrenchblowjobmature analinterracialbig titsblondeBBC

• 23:44 thumb_up 76%

  French hotwife Shared with BBC Hubby & His bisexual colleague Films

  4 years ago

  MatureClubswingercuckolddirty talkwife swapBBC

• 37:50 thumb_up 88%

  Lustful Angelique Luka at hairy pussy sex

  3 years ago

  PornHatstockingspublicfrenchoutdoorMILFcheatinglingerie

• 17:22 thumb_up 67%

  French damsel Doggy Mature Hard Anal - Cum Dripping From Asshole - Hardsex Anal internal ejaculation - Hard slit Fucking - Compilation.

  10 months ago

  MatureClubmomfrenchMILFhomemade

• 16:47 thumb_up 46%

  Nudist Cap D Agde Slut Adventures

  1 year ago

  $$ FapHousefrenchsmokingbeachinterraciallingerienudist

• 58:36 thumb_up 50%

  Chubby french moms hardcore porn video

  4 years ago

  XoZillafrenchswingerstudentjapanese momgerman

• 47:59 thumb_up 84%

  Amina Danger gang bang extreme pour Amina

  5 years ago

  xHamsterfrenchdouble analgangbangBBC

• 19:51

  Mature French woman enjoys double penetration and creampie from two lovers

  3 months ago

  YesVidstattoofrench

• 21:02 thumb_up 81%

  (fullvideocreampie) Mature with Big Breasts from Argentina Goes to the Gyneco...

  1 year ago

  Beegcreampiematureparodyfrenchcelebrity

• 16:13 thumb_up 71%

  MOMMYS CHICK - Nosy Neighbor Caught COUGAR Reena Sky & Daughter-in-law Tiffany Watson - ITALIAN SUBTITLES (Briana Banks, Melissa Moore)

  3 months ago

  PornDrvoyeurmomwifelesbian

• 43:21 thumb_up 77%

  At 70, Eva Proves That Pleasure Has No Age

  6 months ago

  JizzBunkerfrenchblowjobcreampiegrannyclitblondebig clit

• 40:24 thumb_up 90%

  Financial Advisor Fucked and Ass Fucked!: Blowjob, Doggy Cowgirl Porn

  8 months ago

  XXXDanfrenchcreampiematuremissionary

• 16:51 thumb_up 69%

  Offered to a stranger with a condom dildo to be used as a whore and serve as a balls vacuum a camera that films me for my husband

  2 years ago

  xHamstermaturefrenchhooker

• 29:25 thumb_up 82%

  Step mom enjoys big cock anal in a French style

  1 year ago

  XXXVoguedirty talkfrenchhairycougar

• 20:51 thumb_up 42%

  Surprise Anal And Creampie For Horny French Girlfriend - Homemade Couple - Homemade Video - Homemade

  2 years ago

  xTitsfrenchanalcouple

• 21:10 thumb_up 63%

  Des vieilles se retrouvent pour une partouze

  5 years ago

  xHamsterfrenchcreampiegangbangorgy

• 42:42 thumb_up 77%

  Voluptuous amateur MILF Angela breathtaking adult video

  5 years ago

  Analdinmaturemomfrenchsquirt

• 23:59 thumb_up 52%

  Hardcore Sex With Hot Step Cougar next Door

  6 years ago

  xTitsdirty talkweteroticfantasygermankissing

• 22:50 thumb_up 73%

  Compilation Fuck and creampie my slut pussy ass cum in mouth face of whore Tina French Toulouse amateur share comment hard

  2 years ago

  xHamsterfrenchwifeflashingcreampie compilationhookercumshot compilation

• 17:38

  Fidelity test - she cheats on spouse Brit Hotwife Wifey

  6 days ago

  PornDrcreampiewifeblowjobfrenchbig cock

• 26:28 thumb_up 63%

  Extreme Gangbang Creampie Anal Double

  2 months ago

  $$ FapHouseanalcreampiefrenchgangbangamateurdouble penetration

• 21:44 thumb_up 80%

  Threesome Bisex Without a Barge on the Couch: We All Suck Each Other, Double Penetrations, My Husbands Anal Creampie

  8 months ago

  $$ FapHousefrenchcreampiebisexualdouble analhusbanddouble penetration

• 23:27

  COUGAR Cheating Mindi Mink Confronts Cuckold Hubbys Domina Eva Long and Predominates Her Pussy - MYLF

  2 days ago

  PornDrPOVlesbiananalcheating

• 27:41 thumb_up 73%

  Busty French Ebony Teen

  1 year ago

  SunPornoebonyamateurteen (18+)frenchcreampiePOVfetish

• 16:08

  WE SWAY BOTH WAYS - Pristine Verge Spices Marriage With Bisexous Three-way And Dual Intrusion (alison miller, carolina bell, kyrichess, pierce paris, vanebp19)

  3 weeks ago

  PornDrhandjobfrenchanalbisexualthreesometattoo

• 34:57

  Hard Gangbang Creampie with Misschaude

  2 weeks ago

  $$ FapHousecreampiegangbangblowjobfrench

• 37:25 thumb_up 65%

  Divorced, Cougar Stepmother, Horny and Desperate for Sex, Wants to Be Taken in Every Hole - Full Video.

  9 months ago

  $$ FapHousematureamateurfrenchPOVmature analanalcouple

• 36:05 thumb_up 73%

  Stepmother Explains Anal Sex To Her Stepson - Full Anal Creampie

  1 year ago

  SunPornofrenchmature analanalcougarfirst time

• 20:16 thumb_up 57%

  Beurette Marocaine Gros Cul Levrette Francaise

  5 years ago

  TXXXfrench

• 1:11:07 thumb_up 83%

  Emilie french wife gang bang

  6 years ago

  HClipsfrenchgangbang

• 33:40 thumb_up 71%

  I Share The Sofa With My Cousin And Concluded Up Dreaming And Shagging Him - Jennifer White

  2 months ago

  PornDrfrenchcousinwifehandjob

• 15:03

  BIPHORIA - Latino Patient Gets Demolished in Slobber Roast by Fabulous Medic & Otter Intern

  1 week ago

  PornDrmasturbationbisexualwifehandjobfrench

• 24:09 thumb_up 88%

  French milf, Angelique had casual sex with Luka and liked how it felt, including a massive creampie

  6 years ago

  TXXXfrench

• 27:24

  Boys, Ass Fuck Me, Cum in My Mouth and Pussy I Love It Especially When You Do It at the Same Time!

  5 days ago

  $$ FapHousefrenchMILFcum in mouthcreampie

• 35:01

  Amateur light-haired tucked in all her fuck holes by 2 men

  2 weeks ago

  PornDrthreesomefrenchhandjob

• 21:45

  Julie Holly receives an intimate French lesson in anal creampie with James Band

  3 months ago

  YesVidsreality

• 32:41

  Nasty German bitches sharing weenie in a super-fucking-hot 3some

  6 days ago

  PornDrthreesomefrenchcreampiematurevintage

• 44:31 thumb_up 61%

  Fucking My Husband

  5 years ago

  xHamsterbisexualthreesomehusbandgangbangMILF

• 34:34 thumb_up 85%

  Astonishing Xxx Clip Milf Amateur Craziest Pretty One

  4 years ago

  HClipscastingass lickingsmall titsfrench

• 23:26 thumb_up 69%

  Vanessa Alessia is a quickie on a fast train with a cheating beauty

  2 years ago

  XXXDancreampiejapanese lesbianjapanese massagecelebrityquickie

• 24:54 thumb_up 57%

  Blonde BBW mature French fucked until creampie

  1 year ago

  XXXDanfrenchmature analanalfacialslutgranny anal

• 15:11 thumb_up 80%

  MilfAf- Scottish Cougar Penny Peaks Caught Twat Massaging Then Pulverized Rock-hard

  2 months ago

  PornDrhandjobbeautyfrenchcreampiemassagewifecaught

• 38:45 thumb_up 77%

  EMILIE BBW X 3 COCKS

  1 year ago

  JizzBunkerfrenchcreampieanalbig assbondagegangbang

• 25:40 thumb_up 69%

  Emma Klein

  5 years ago

  xHamsterdouble analfacialdouble penetration

• 17:31

  Anal Creampie. Hot Big-assed MILF Gets Sodomized by Her Stepsons Big Cock

  1 month ago

  $$ FapHousecreampiefrenchblack

• 34:57 thumb_up 89%

  Lustful MILF Sophie french incredible adult video

  5 years ago

  Analdincumshotfrenchsquirtcreampie

• 22:53 thumb_up 52%

  18 year old girl with massive smooth-shaven lips! Close-up jizz flow real orgasm

  1 year ago

  HDSexindianteen (18+)arabcreampieasianteen anal (18+)orgasm

• 28:22 thumb_up 60%

  Hubby pleads his steaming wifey to poke a black boy near pool

  4 weeks ago

  PornDrwifefrenchinterracialcreampie

• 22:37

  Ava Addams Takes off Down And Soaps Up Her Good-sized Udders In A Hot Bathroom Taunt Flick

  6 days ago

  PornDrcreampievoyeurfrench

• 48:42 thumb_up 60%

  My French Stepmom Wants to Be Friends Immeganlive

  1 year ago

  BeegfrenchMILFcreampiestepmomreality

• 27:51

  Threesome with Two Strangers for This Naughty Girl with Glasses!

  Yesterday

  $$ FapHousefrenchBBW

• 25:49 thumb_up 46%

  Steamy Desi Indian Pandit poked the doll on the pretext of horoscope

  1 year ago

  MatureClubcreampieasiancreampie compilationass lickingauntfirst timecum on pussy

• 16:13 thumb_up 71%

  Amateur Homemade Passionate Couple - Pussy Fuck Anal Creampie - Hot Sex - Full Video

  1 year ago

  $$ FapHousehomemadefrenchanalcouplehairyshort hair

• 17:05

  Two adults share a quiet moment of tender intimacy when left alone together

  3 months ago

  YesVidsdutch

• 31:38

  Cougar mega-bitch gets rock-hard rectal shovels on a 3 way encounter

  1 week ago

  PornDranalsolo

• 50:03 thumb_up 70%

  Casting Anal Pour Salope Brune Francaise

  3 years ago

  HClipsfrenchdeepthroatcreampiehairycasting

• 40:08

  Big Boobed French Babes Sharing Dick And Cum In Anal Ffm Threesome With Lana Fever

  9 months ago

  HClipsvintagefrenchsmokingFFM

• 1:02:15 thumb_up 87%

  French brothel retro full

  4 years ago

  JizzBunkerpublicvintagecreampie

• 37:17 thumb_up 75%

  Take care of my mother

  1 month ago

  PornDrfrenchinterracialmasturbationwifecreampieMILF

• 23:50 thumb_up 82%

  Cute Amy gets fucked in the ass right after her friend Anastasias pussy is fisted

  2 years ago

  JizzBunkercreampiebeachfrenchlesbianhardcorefisting

• 50:33 thumb_up 80%

  Big-boobed bride cheats on her wedding with an elderly stripper

  4 months ago

  PornDrcreampiehandjobfrenchbridecheatingwedding

• 19:09 thumb_up 74%

  Cologne mommy gets nicely stuffed at a wild gangbang party

  1 year ago

  XXXVogueindianteen (18+)frenchcreampiegermanpartyMILF

• 47:34 thumb_up 83%

  Une Psychologue De 31 Ans Aime Sucer et Se Faire Prendre

  5 years ago

  TXXXfrenchcreampiemature analstockingsoutdoor

• 24:18

  24 Cm of a Huge Xxl Cock in My Ass.

  4 weeks ago

  $$ FapHousefrenchcreampieBBCafrican

• 28:58

  Stunning blond gets fisted by ultra-kinky chocolate-colored-haired tramp

  2 weeks ago

  PornDrmasturbationcreampiefrenchlesbianreality

• 17:33 thumb_up 59%

  Dirty talking mature stepmom gets her ass filled with cum

  1 year ago

  XXXVoguedirty talkfrenchhomemade

• 25:55

  2 lesbo mates who derived sheer pleasure from engaging in deep throat vibration of each others genitalia

  1 week ago

  PornDrlingerielesbianfrench

• 39:10 thumb_up 75%

  French Malika

  1 year ago

  HClipsebonyfrenchcreampieanalthreesome18

• 15:41 thumb_up 53%

  En Nque De Sexe Je Baise Ma Femme Dans Cuisine Et Elle Squirt Sur

  3 years ago

  HClipsfrenchinterracialamateurcreampie

• 25:28 thumb_up 74%

  Slutty mature gets fucked in all holes

  12 years ago

  TXXXfrenchbukkakegangbangmature

• 19:48 thumb_up 67%

  Gorgeous french MILF emotional adult scene

  2 months ago

  XoZillablackteen (18+)frenchold mangermanteen anal (18+)footjob

• 22:53

  2545eo_ii - French Amateur, Clothed-sex, Satin Lingerie, Rimming, Blowjob, Cumshot

  8 months ago

  $$ FapHousecumshotstockingsfrenchmassageprostate

• 27:30 thumb_up 67%

  Stepmother gives her figure to son to stop his super-naughty fuckfest

  3 months ago

  PornDrfrenchcreampieMILFstepmommasturbationreality

• 33:43 thumb_up 90%

  The French MILF known as Julie Holly receives an anal creampie from Mugur during the time her husband is away at work.

  8 months ago

  TXXXfrenchanalcreampiemature analblonde

Categories

Other free porn sites