Mature • European 36,143 videos

• 40:21 thumb_up 76%

  Orgy big saggy tits mature

  2 years ago

  VipTubebig titsorgysaggy titshardcorebrunettegroup

• 33:18 thumb_up 85%

  Alex Jsex, riesen Facial nach Anal in der Kueche

  5 years ago

  xHamsterhomemadefrenchmature analshort hair18swallowcum in mouth

• 17:50 thumb_up 87%

  Brunette milf bekommt orgasmus auf der casting couch

  3 years ago

  xHamstercastingamateurauditionvintagesmall titsgerman

• 20:17 thumb_up 82%

  Slim Hairy Granny And Young Boy

  3 years ago

  HomemadeXXXhomemadepublicfatswingergermanmature analnurse

• 31:12 thumb_up 79%

  Shameless GILF filthy porn story

  3 years ago

  HomemadeXXXamateurhomemadecreampiegermanmature analanalthreesome

• 2:58:16 thumb_up 80%

  90s teen chick gets seduced by two retro lesbians and enjoys licking off

  9 months ago

  AroundXXXseducedlesbian

• 15:39 thumb_up 78%

  My step mom was satisfied with my friend s visit: Amateur, Xnxx Homemade Porn

  4 months ago

  JizzBunkermomamateurhomemadestepmomrussian

• 23:00 thumb_up 87%

  Skinny Girl From Berlin Hot Amateur Porn

  3 years ago

  HomemadeXXXamateurhomemadeold mangermanmature analanalnurse

• 1:25:13 thumb_up 50%

  A community that practicing free love

  11 years ago

  Beegcutefrenchlesbianasian18gangbangmasturbation

• 26:19 thumb_up 70%

  Ein Schwanz langt Ihr nicht

  4 years ago

  xHamstergermanfootjobpussymaturevintagehardcore

• 53:45 thumb_up 71%

  TOP 5 SOLO MATURE COMPILATION! JUICY MATURE cunt - amateur european

  5 months ago

  VideoSectionmatureamateurfeetorgasmhairysolocompilation

• 19:41 thumb_up 84%

  Deutsch Extreme 3 - Episode 2

  3 years ago

  xHamsteramateur

• 23:05 thumb_up 80%

  Hairy Mommy Agneta Cougar ass fucked in amateur hardcore with cum on pussy

  3 years ago

  HomemadeXXXmomgermanmature analbig assdoctorasianoutdoor

• 20:36 thumb_up 87%

  Costas gives his favorite mature neighbor a huge facial - German retro

  4 years ago

  xHamstergrannyhairycum in mouthvintagegermanneighbor

• 44:09 thumb_up 79%

  Mature Mommy Ana Teases And Superfucks Two Inexperienced Rooks

  3 years ago

  TXXXmatureamateurmomspanishteasebig tits18

• 18:18 thumb_up 78%

  German Granny Gone Crazy

  4 years ago

  Beeggermangrannyoutdoormature

• 1:41:49 thumb_up 63%

  Italian retro horny milf is spying sexy blonde dressed in white stockings

  9 months ago

  AroundXXXitalianvintagestockingsspydressanal

• 45:39 thumb_up 86%

  I Love The Female Orgasm So Much Compilation

  3 years ago

  HomemadeXXXhomemadeorgasmcheatingfootjoblatinaofficecompilation

• 26:31 thumb_up 75%

  Omi mit mega Busch gefickt

  3 years ago

  xHamstergermangrannyhairybig clitsaggy tits

• 1:42:25 thumb_up 74%

  Escort A Domicile (2018) - Full Movie

  3 years ago

  HDZogstockingsfrenchanalfull movieescortlingerie

• 36:13 thumb_up 80%

  Inner Massage

  1 year ago

  xHamsteranalbig assmassageMILFczechbig titsblonde

• 47:28 thumb_up 62%

  For the first time at a swingers party

  4 years ago

  xHamsterteen (18+)swingerpartyczechorgyclub

• 1:32:34 thumb_up 82%

  Liaisons coupables (1987, Sandra Morin, full video, DVD)

  4 years ago

  xHamsterfrenchvintagefull moviehardcore

• 1:20:32 thumb_up 82%

  Initiation Of A Married Woman (1983)

  3 years ago

  Uporniafrenchvintageanaldouble penetrationhairylingerie

• 32:28 thumb_up 61%

  I recommend everyone to bound and fuck your stepmother! I do it everyday!

  3 years ago

  xHamstermatureamateurbondagedoggingstepmomdominationhardcore

• 1:49:07 thumb_up 88%

  Fabulous Adult Video Casting Exclusive , Watch It - Lexy Gold

  2 months ago

  HClipscastingcreampieanalfetishbig cockdouble penetration

• 18:02 thumb_up 72%

  British milf fucks a young guy

  3 years ago

  JizzBunkermature analanalbritish

• 1:09:42 thumb_up 67%

  Tears and Blood 2003 Full ITA movie

  9 months ago

  AroundXXXlingeriedouble analorgyfull moviedouble penetrationstockings

• 23:54 thumb_up 91%

  Schlampe blas und ich ficke dich in dein Arsch

  4 years ago

  xHamsterteen (18+)germanmature analteen anal (18+)orgasmass lickinggroup

• 17:18 thumb_up 82%

  French milf blowjob

  1 week ago

  IcePornanalfrench

• 26:08 thumb_up 84%

  Puma pervert!!! - Tom. 08

  3 years ago

  XXXDangermanvintagecougarhardcore

• 20:39 thumb_up 86%

  Grandson rehabilitates his grandmother

  6 years ago

  xHamsterkissinggermancumshothardcoregranny

• 15:52 thumb_up 79%

  Hot MILF Gets Fucked Hard in the Ass Outside and Shows Her

  1 week ago

  IcePornamateur

• 17:14 thumb_up 83%

  Ugly Fat Maid Join in Anal 3Some Sex with German Mature Couple

  2 years ago

  xHamstermaturefatgermananalthreesomecoupleBBW

• 1:04:47 thumb_up 73%

  German Milf Moni - Part Nine

  3 years ago

  HClipshandjobamateurstockingsgermanMILFgangbangcum in mouth

• 1:17:30 thumb_up 80%

  Vieilles Mamelles Et Jeunes Baiseuses

  4 years ago

  TXXXfrenchgranny analgrannyBBW

• 1:31:11 thumb_up 69%

  Anal Clinic (1993, France, full video, Julia Channel, 2k)

  4 years ago

  xHamsterfrenchclassicfull moviehairy

• 17:55 thumb_up 77%

  Sex with a horny single vacation home owner 2

  2 years ago

  JizzBunkerhiddenupskirtvacationheelsswallow

• 18:52 thumb_up 78%

  Lisa comes weekly to be fucked

  4 years ago

  BeegpantyhosegermanblondematureMILFhardcore

• 22:53 thumb_up 72%

  Hot wife gets satisfied by her neighbor

  1 year ago

  xHamsterkissinggermanwifebig clitcum in mouthseducedneighbor

• 15:13 thumb_up 82%

  When stepson's dick is too big for anal sex. Real scene.

  1 year ago

  xHamsterhomemademature analteen anal (18+)doggingnaturalbig cockgranny anal

• 3:27:27 thumb_up 71%

  Toy Teeny The vintage Vol.1 Collection

  3 years ago

  xHamsterbig clithungarianpussycompilation

• 18:17 thumb_up 77%

  Sabrinas erste bukkake Party

  4 years ago

  xHamstergermanpartybukkakeswallowasscum in mouth

• 21:29 thumb_up 74%

  71 Year Old GILF Hot Sex Scene

  3 years ago

  HomemadeXXXhomemademature analanalinterracialMILFfistingcheating

• 38:45 thumb_up 67%

  Retro deutsch! Oma Ingrid ist dauer geil!

  3 years ago

  xHamsterpissingamateurgermangrannyBBWbig titsmasturbation

• 1:05:00 thumb_up 44%

  Documentaire (21 jours)

  6 years ago

  xHamsterMILF18celebrityfrench

• 1:57:09 thumb_up 79%

  Old Horny Granny To Fuck

  2 years ago

  TXXXmaturegranny

• 1:34:51 thumb_up 71%

  Geheimer Skandal 20 (Full Movie in HD Version)

  3 years ago

  xHamsteramateurgermanfull moviestory

• 30:26 thumb_up 76%

  Nice Hairy Granny Gets Fucked By Young Son 1080

  3 years ago

  Uporniastockingsgrannyhairyfacialdutchdouble penetration

• 32:00 thumb_up 86%

  Sharing the bed with Stepmom again, she agrees because she is too horny!

  2 years ago

  xHamstermomrussianchubbyBBWcougar

• 36:45 thumb_up 77%

  SUPER-HOT-GRANNY. Fina is back, and wants more dudes to fuck

  4 years ago

  xHamsterspanishgrannyMILF

• 15:43 thumb_up 70%

  German street whore secretly filmed in Duisburg - 80s retro

  3 years ago

  xHamsterhiddengermanMILFcarwhorenylon

• 16:47 thumb_up 59%

  Charming stunner incredible sex scene

  3 years ago

  Analdinspybukkakecartooncelebritygerman

• 21:43 thumb_up 92%

  Ungewollt den ersten Porno gedreht Ups - wenn der Fotograf schon mal da ist

  3 years ago

  xHamstergermanorgasmclassicridingvintageskinnypussy

• 21:54 thumb_up 79%

  Pizza Giuseppe likes to deliver to widowed grannies, why? retro fun

  4 years ago

  xHamstergrannychubbyhairyBBWass to mouth

• 15:16 thumb_up 83%

  SHAME4K. He just did What was Written and Creampied Her ft. Fotina: Porn

  6 days ago

  XXXDanmaturecreampiecougar

• 1:01:09 thumb_up 76%

  My First Swingers Party And My First Real Orgasm

  3 years ago

  xHamsterkissingswingerbisexualpartyorgasmczechorgy

• 42:15 thumb_up 67%

  Compilation

  6 years ago

  xHamsterMILFbig titscompilationBBW

• 3:06:25 thumb_up 71%

  C'era una volta il GRAND HOTEL - (Film Completo)

  3 years ago

  xHamsteritaliancelebrityhotelvintage

• 1:06:17 thumb_up 82%

  Lesbians in bedroom

  5 years ago

  xHamsterlesbianpussy

• 27:29 thumb_up 85%

  Blonde Notgeile Mitarbeiterin direkt eingewiesen wie hier gearbeitet wird

  4 years ago

  xHamstersybianskinnyvintageasshairy

• 24:24 thumb_up 85%

  My Asshole Is All Yours - CHAPTER #01

  3 years ago

  xHamsteranalgrannyrussianMILF18cougargranny anal

• 22:38 thumb_up 71%

  Horny German teen with perfect pussy and massive tits gets fingered and ejaculated on

  1 year ago

  XXXVoguefatchubbyBBWbig titssquirt

• 31:51 thumb_up 59%

  Indian MILFs hot amateur threesome sex

  3 years ago

  HomemadeXXXamateuranalindianfantasyBBC

• 25:49 thumb_up 76%

  Cute mature housewife has her first porn movie experience

  3 years ago

  xHamsteramateurmomhousewifesmall titsfirst time

• 22:22 thumb_up 80%

  European Milf doing it in a car

  6 years ago

  Beeghandjoblingeriecarclothedstockings

• 30:58 thumb_up 67%

  Mature lady gets fisted and fucked. Then she joined her step-daugher

  12 years ago

  Beegmaturestockingsmature analanalthreesomefistingFFM

• 24:18 thumb_up 74%

  Swapping Pussies.. second couple

  1 year ago

  xHamsterMILFthreesomecouplecum on pussycumshotwife swap

• 18:19 thumb_up 75%

  Female dominance JOI – You’re mine and you will jizm for me.

  1 year ago

  VideoSectionblackfemdomfrenchinstructiondirty talknylonJOI

• 1:07:20 thumb_up 72%

  Sexy European Teen Sandra Crosses Her B - Creampie

  4 years ago

  xHandhandjobteen (18+)voyeurgaggingteen anal (18+)gangbangcum in mouth

• 21:07 thumb_up 75%

  Junge Mutter Outdoor gefickt

  4 years ago

  xHamstermaturegermanoutdoordoggingblondeskinny

• 25:11 thumb_up 81%

  Horny couple fucks teen nanny

  3 years ago

  XoZillateen (18+)threesomecouplegermanhomemade

• 24:13 thumb_up 67%

  Amateur Sex

  6 months ago

  $$ FapHouseamateurhomemadecouplechubbypolishnaturalhairy

• 1:49:54 thumb_up 70%

  HAUSMEINSTER - (GANZER FILM)

  3 years ago

  xHamstergermanamateur

• 19:54 thumb_up 77%

  Kinkiest Lesbos in the World

  1 year ago

  xHamsterpissinglesbianoutdoororgasmlingerieclitshower

• 1:34:33 thumb_up 74%

  Fuckin At 50 #23

  4 years ago

  xHamstermomorgygrannymaturegroup

• 1:32:01 thumb_up 71%

  Swingers Club 24

  3 years ago

  Uporniafrenchclubdouble penetrationswinger

• 1:50:44 thumb_up 72%

  French mature anal hot

  6 years ago

  xHamstermaturefrenchmature analgrannyhardcoregranny anal

• 20:21 thumb_up 80%

  Anna wird vor dem Ficken erst mal rasiert

  4 years ago

  xHamstercastinggermanamateurhairydildolingerie

• 22:16 thumb_up 58%

  Hottest Grannies Compilation BBW Porn

  3 years ago

  Analdinhandjobhomemadecreampiegermanmature analasianfisting

• 1:36:30 thumb_up 72%

  Where do I put it to the old lady? (full movie in italian hd)

  3 years ago

  xHamsteramateuritaliangrannyfull moviegranny analmature

• 48:02 thumb_up 80%

  Money-needing 48yo mature professor plows her 18yo schoolgirl on her free day!

  6 years ago

  HDSexamateurfatblowjobspanishmoneychubbyBBW

• 36:03 thumb_up 77%

  Bianca and Ember 69 with Strap on Lesbian Action

  2 weeks ago

  $$ FapHousematureamateurlesbiannaturalstraponkissing

• 24:54 thumb_up 83%

  Christmas Party With Horny Stepmom

  3 years ago

  HomemadeXXXmatureamateurmomhomemadeold mangermanparty

• 26:18 thumb_up 79%

  Shameless mom filthy IR porn movie

  3 years ago

  HomemadeXXXmomhomemadeswingerwifewhorejapanese momjapanese lesbian

• 42:13 thumb_up 81%

  Mature with huge clit

  7 years ago

  xHamsterhomemadegrannyclitbig clit

• 1:23:07 thumb_up 78%

  Short haired matures showing off their amazing cockhandling skills

  6 years ago

  Analdinthreesomerussianshort haircompilationgangbang69group

• 25:53 thumb_up 75%

  Missionary Compilation #3 by Little Blonde - Cum Inside Me!!!

  2 months ago

  $$ FapHousecreampiespanishcreampie compilationcompilationcumshot compilationmissionary

• 23:12 thumb_up 77%

  Bi-Sexual Cuckold Husband and His Wife Interracial Sex

  3 years ago

  Analdingermanbisexual

• 29:49 thumb_up 82%

  She doesn't look like a double anal slut, does she?

  4 years ago

  xHamsterfrenchanalMILFglassescum in mouthgroup

• 15:18 thumb_up 79%

  Sweet Pantyhosed Lesbos

  1 year ago

  xHamstermaturelesbianstockingspantyhoseamateurnylon

• 3:44:28 thumb_up 69%

  Stunden u 40 Teil 2 (Full Movie)

  3 years ago

  xHamstergermanfull moviestory

• 1:31:08 thumb_up 74%

  Mes Voisines Sont Poilues (2007)

  6 years ago

  xHamsterfrenchanal

• 29:22 thumb_up 85%

  Friendly Neighbor - Freundlicher Nachbar

  6 years ago

  xHamstergermanneighborhardcore

• 16:24 thumb_up 88%

  Cougar shocks us all with her lack of limits at HER very first porn!

  7 months ago

  MatureClubmombig titsamateurspanishreality

• 28:41 thumb_up 73%

  Amateur Porn Facial Compilation

  3 years ago

  AnaldingermanBDSMcompilationstripcartooncumshot compilationcelebrity

• 33:02 thumb_up 75%

  If you want to bake a cake, you need protein

  4 years ago

  xHamsterfrenchanalMILFass to mouthcum in mouthkitchen

• 1:08:00 thumb_up 59%

  Franceska gets disgraced in public

  14 years ago

  BeegfistingBDSMtiedFFMgangbanggroupdress

• 18:02 thumb_up 85%

  Granny and her boarder

  6 years ago

  xHamstergranny

• 20:22 thumb_up 74%

  Maid catches panty wanker

  3 years ago

  xHamsterhandjobblowjobcreampiebisexualmaidbritishpanties

• 19:00 thumb_up 79%

  Crazy Fuck

  2 weeks ago

  NuVidamateur

• 35:53 thumb_up 83%

  Schwiegermutter beobachtet uns beim Sex und will dann ficken

  4 years ago

  xHamsterhomemadegermangrannysaggy tits

• 32:41 thumb_up 72%

  Amateur MILF deepthroats a dick

  6 years ago

  Beegfrenchupskirtcum in mouthclothedamateur

• 15:20 thumb_up 73%

  Deutsches Lesben Casting Tell me more 2 echte deutsche Schnitten

  4 years ago

  xHamstercastingkissinglesbianfistingclassicauditionvintage

• 24:58 thumb_up 86%

  Hard Experience

  4 years ago

  xHamstergrannyhardcorevintage

• 1:23:02 thumb_up 79%

  Orgien der Wollust (1987, German, Karin Schubert, DVD rip)

  4 years ago

  xHamstergermanclassicvintagebig titshairy

• 25:01 thumb_up 83%

  Dont Worry About My Husband

  6 years ago

  TXXXitaliangermanMILFczechhusbandswedishnorwegian

• 33:27 thumb_up 67%

  VECCHI DEPRAVATI ITALIANI!!! - Episodio #04

  3 years ago

  xHamsteritaliancougarMILFamateur

• 42:46 thumb_up 87%

  Hardcore Anal fuck mit verheirateter Frau

  3 years ago

  xHamstergermanmature analbusclassicseducedhousewifeskinny

• 37:34 thumb_up 61%

  I Take Out My Dick With Sperm In Risky Public Places Compilation!

  3 years ago

  HomemadeXXXpublicold manbondagecompilationcaughtsperm

• 23:51 thumb_up 85%

  Guy fucks old, fat prostitute

  3 years ago

  xHamsterfatshort hairass lickingprostitutewhore

• 16:38 thumb_up 75%

  Lisa est une femme tres gourmande de sexe

  4 years ago

  xHamsterfrench

• 29:23 thumb_up 82%

  Fun With Teenage And Mature Woman

  3 years ago

  Analdinamateurhomemadeteen (18+)germanthreesomewifeFFM

• 1:34:51 thumb_up 73%

  Geheimer Skandal 2 (Full Movie in HD Version)

  3 years ago

  xHamsterfull moviestory

• 17:55 thumb_up 68%

  Williges Girl holt sich den Schwanz wenn sie ihn will

  4 years ago

  xHamstermaturegermandildoblonde

• 1:03:12 thumb_up 78%

  Les Nymphomanes (1980, France, full movie, HD rip)

  4 years ago

  xHamsterfrenchnurseclassicvintagefull movie

• 17:11 thumb_up 86%

  Er steckte seine ganze Hand in Ihre Fotze

  4 years ago

  xHamsterblowjobgermanorgasmfistingridingdeepthroatskinny

• 33:28 thumb_up 90%

  Juicy mature amateur Tamara Val gets her butt fucked outdoors

  4 years ago

  xHamsterfrenchmature analswallowcum in mouthanal

• 19:48 thumb_up 82%

  Alter knacker benutzt seine Stieftochter fuer das volle Programm

  3 years ago

  xHamstergermanamateur

• 26:16 thumb_up 84%

  Boat day for a swinger couple with a man banging a young stunning blonde

  4 years ago

  Beegfrenchswingercouplehardcoreamateurriding

Categories

Other free porn sites