Mature • Cunt Orgasm 12,455 videos

• 10:21 thumb_up 68%

  Horny Mexican Latina confesses her desire for intense lovemaking and craves two dicks to cover with milk

  1 year ago

  XXXVoguemilkmexican

• 26:28 thumb_up 81%

  Mature lady sits on grandmas face

  11 months ago

  MatureClublesbianorgasmBBWfacesittingnipplesfingering

• 11:20 thumb_up 91%

  Yes Cum In Me ! I love To feel molten Cum !

  5 months ago

  VideoSectionhomemadefrenchcreampiesmokingmature analorgasmcheating

• 12:25 thumb_up 73%

  Desi Family hookup , stepfather Caught His Stepdaughter For Sex From Outside Village

  9 months ago

  VideoSectionmomrussianorgasm18ass to mouthcaughtaunt

• 08:14 thumb_up 69%

  Lety Howl En trio Avec Gian Et Ohana Strap on Pipe Double Penetration FFM anal invasion Et cuni

  1 year ago

  VideoSectionorgasmlesbianthreesomedouble penetrationpeggingFFM

• 05:16 thumb_up 57%

  The intercourse machine brought the stepmom to ejaculation

  6 months ago

  HDSexsquirtrussianstepmomnaturalmachinebareback

• 25:29

  Indian mallu aunty kavitha kottayam sex with chief in a hotel and groaning noisy.

  3 weeks ago

  MatureCluborgasmhotel

• 25:19 thumb_up 89%

  My super-naughty pal coaxes me to be a whore with her

  1 month ago

  VideoSectionlesbianmaturewhorefeet

• 32:13 thumb_up 75%

  Amateur wife strokes with orgasm and yells. molten brunette massages sensual hair pussy, big ass, b

  4 months ago

  MatureClubamateurhairywifesquirt

• 05:15

  Unplanned sex in an office between stepdaughter and stepmother

  2 days ago

  MatureClubbig assfrenchmasturbationamateurhomemadematurecumshot compilation

• 18:56

  Steaming wife cheats on her husband with bricklayer, paying with assets - Melanie Caceres

  6 days ago

  VideoSectionblowjobhomemaderussianorgasm

• 05:39 thumb_up 85%

  Oops!) I wet my panties again! I lifted my skirt, put my fingers on my panty pussy and had an orgasm before I took off m

  3 years ago

  xHamsterpantiesaccident

• 15:57

  Busty Thaiger explodes with pleasure as she takes a massive faux-cock

  5 days ago

  XXXVoguebarebackBBWamateurorgasmass to mouthpantiessquirt

• 05:41 thumb_up 81%

  Mother-in-law with her huge beaver and melons sequence 1

  9 months ago

  VideoSectionmomgrannyrussianhairyBBWass to mouthmasturbation

• 05:33 thumb_up 81%

  Lorelei Solo Morning orgasm With thumbs

  3 months ago

  MatureClubsoloamateurorgasm

• 05:19 thumb_up 60%

  Hairy pussy amateur wife, big tits, big nipples, big bum. amateur wife blowjob, furry pussy, big ass.

  3 months ago

  MatureClubcouplehairywifepantiesnipplesmassage

• 05:15 thumb_up 67%

  Wifey Invited bang-out Slave to Lick Her gash. Ep 21031

  1 month ago

  HDSexfacesittingcuckoldfemdom

• 07:13 thumb_up 86%

  Mummy Does a superb Job licking a Mans Ass During Fisting

  3 months ago

  VideoSectionhuge dildoanalamateurfisting

• 15:26

  After deep kissing she fingers her ass as she gobbles her wet cootchie - kissing HD

  1 week ago

  HDSexorgasmlesbian

• 39:09 thumb_up 80%

  Wife wakes me up for some anal creampie fun on camera with Dorian Del Isla and Cassie Del Isla

  1 month ago

  XXXVoguecreampieanalmature

• 26:02

  Wife cheats with BBC while husband watches in the faphouse

  1 year ago

  XXXVoguemoneyswinger

• 05:56 thumb_up 68%

  Oh My God! My Stepson Has Gone insatiable, He pulverizes Me in the Kitchen While My Step-father Is Not Home

  11 months ago

  VideoSectionindianteen (18+)squirtorgasmass to mouthcompilationcaught

• 26:19

  German housewives have affairs behind their husbands backs

  1 year ago

  XXXVoguehousewifegermanhomemade

• 10:35 thumb_up 56%

  First-time creampie with blonde cougar Richelle Rose gets wild with Alexander Gary

  6 months ago

  XXXVoguecastingorgasmbondageBDSMspankingcougarcollege

• 44:46

  Aimee Paradise and Peter Stone - Erotic saga of a steamy older woman: Sexual escapades volume 26

  1 year ago

  XXXVoguecelebrity

• 34:56 thumb_up 62%

  Mr. Majic & the Wonder Twins

  1 month ago

  HDSexcum in mouthblackBBCthreesomeFFMsquirt

• 06:28

  Housewife Ginger enjoys solo session in strawberry panties

  Yesterday

  XXXVoguesolohousewifemasturbationamateurmomorgasm

• 14:13

  I show my big furry cooch to my stepson so we can wank together

  2 weeks ago

  HDSexcuckoldhairyamateur

• 15:30 thumb_up 89%

  Insatiable Mature lesbo Seduces Sexy Teen Into Girl on Girl Affair - AMATEUR euro

  1 month ago

  HDSexlesbianamateur

• 05:16 thumb_up 50%

  55 year old british cougar shows her hairy cunt

  1 year ago

  xHamsteramateurorgasmhairybritishslut

• 08:22 thumb_up 73%

  Milf with the Magic labia

  5 months ago

  HDSexfartingmaturemomorgasmcreampie

• 14:13

  Dual grannie enjoy Fresh Meat

  2 weeks ago

  VideoSection3Dgrannybisexualold and young (18+)

• 15:40 thumb_up 82%

  Mature lesbian gives G spot orgasm - Lesbea

  3 months ago

  VideoSectionlesbianmaturenipplespanties

• 06:50 thumb_up 82%

  Huge orgy at the first casting for a cheating wife in uncensored anime

  6 months ago

  XXXVogue3Djapanese uncensoredmomanalorgygroup

• 07:30 thumb_up 85%

  Opened up gams at the Highway - Popp Sylvie on trip

  2 years ago

  VideoSectionpublicvoyeurorgasmflashing

• 08:14 thumb_up 67%

  Hotwife wife Has first-ever Threesome with Neighbors

  3 months ago

  HDSexthreesomeorgasmcheatinglingeriecaughtnaturalFFM

• 09:01 thumb_up 80%

  Cunt and cock squirt while we watch my fuck video with a stranger

  1 year ago

  xHamsterwifehairyhandjobsquirt

• 06:34

  Unexperienced wife dances naked around the mansion.

  1 week ago

  MatureClubhandjobsolowifehairyblowjob

• 1:00:14 thumb_up 70%

  Compilation of intense orgasms and messy pop-shots featuring top models in erotic massage rooms

  1 year ago

  XXXVogueorgasm compilation

• 10:45 thumb_up 63%

  Mature MILF anal creampie collection - fsp-productions

  1 year ago

  XXXVoguecreampie compilationorgasm compilationcumshot compilation

• 28:57 thumb_up 77%

  Squirting orgasm action with flexible Hanna and Laruna Mave in a wild teen threesome

  8 months ago

  XXXVoguehomemadeteen (18+)squirtthreesomerussianpolishFFM

• 09:22

  Strangers manages my puss and gives me an intense orgasm.

  1 week ago

  MatureClubblondestepmommommaturesquirtorgasm

• 15:59 thumb_up 83%

  Mature business gal internal ejaculation before she leaves spouse - MOM XXX

  7 months ago

  VideoSectionmaturemomMILFpussy

• 27:56

  Real homemade threesome with real girl climax. MFM. Part 2. 21613

  7 months ago

  HDSexthreesomecuckold

• 05:27

  Mature lesbos Molly and Shooting starlet Really Can orgasm

  3 days ago

  HDSexmaturelesbianorgasm

• 04:58 thumb_up 43%

  Fuck a MILF in slow motion

  2 years ago

  xHamstersperm

• 15:46 thumb_up 73%

  Mature mommy Laura and her junior lover Vika Lita explore each others bodies with fingers

  3 months ago

  XXXVoguemomfeetkissinglesbianshavingskinnysmall tits

• 07:45 thumb_up 38%

  I want a lollipop to open the puckered culo of a mature milf

  4 months ago

  MatureClubjapanese momhairymasturbationass to mouth

• 11:58 thumb_up 72%

  Watch Carmen, the naughty granny, pleasure herself on her massive bed with toys

  1 year ago

  Sexumaturewifehairypussysolo

• 1:03:34 thumb_up 79%

  Two busty lesbians cant wait to taste each others juicy pussies

  4 weeks ago

  XXXVogueorgasmlesbianamateurfeetass lickingpussy

• 07:43 thumb_up 64%

  Confused Turkish Muslim wife encounters bizarre American visitor at her home!

  1 year ago

  XXXVoguearabauntturkishcuckoldhairy

• 10:47 thumb_up 61%

  Neat my pearl

  7 months ago

  HDSexfemdomlesbianpiercingdanishold and young (18+)full movie

• 12:53 thumb_up 83%

  All the women Want to slurp Her muff

  9 months ago

  MatureClubhomemadelesbianbisexualthreesomeorgasmpiercingcompilation

• 24:15 thumb_up 53%

  Watched in bedroom fucking machine makes cunt squirt

  2 years ago

  xHamsterhiddenwifeflashingmachinegrannymature

• 11:47

  Colombian stepmom loves being filmed while getting her big booty pleased and enjoys moaning a lot

  1 week ago

  XXXVoguematuremomass lickingorgasm

• 17:42

  Two mischievous hot Wives Invite a BBC to Play.

  4 months ago

  HDSexlesbianmaturebritishsquirtstockingsFFM

• 09:14

  Spouse nasty to Be a cheating Again and Watch Me with Others

  4 days ago

  VideoSectioncuckoldcoupleamateurorgasm

• 05:58

  Curvy doll Tigerlynnn plays with her thick pussy until she creams everywhere

  2 weeks ago

  XXXVoguesquirtchubbymatureorgasm

• 10:35

  Mature wife Bella naked Needs A hotwife Orgasm

  1 week ago

  MatureClubmaturesmall titsbritish

• 15:31 thumb_up 71%

  Edible American MILF Plays With Her Juicy Cunt - fledgling euro

  2 months ago

  VideoSectionass to mouthsolofeetchubbydirty talk

• 35:01 thumb_up 80%

  Lovingly he licks her hairy cunt before he fucks her hard

  1 year ago

  xHamsterhandjobhairymatureskinnywifedildoamateur

• 1:00:26 thumb_up 50%

  Hot gang-fuck from chinese

  1 year ago

  HDSexmature analasianchinese

• 01:49 thumb_up 81%

  Sub Sarah Demands Pussy Licking From Neighbor

  2 years ago

  xHamsterfemdomgranny

• 16:48 thumb_up 82%

  Portland gangbang inspection - Cliff Media

  1 year ago

  XXXVogueskinnydouble penetrationbisexual

• 06:00 thumb_up 38%

  Princess Martine unloads in solo play - Grandmams

  1 year ago

  XXXVoguegranny

• 13:26

  59 yr older mature Latina Balla pulls down her jeans to show off her big hairy muff

  3 days ago

  MatureClubstepmommaturemomhairymasturbationpussy

• 05:26 thumb_up 67%

  First-time couple enjoying a bath, with wife sporting a hairy pussy, big booty, and ample jugs

  3 months ago

  XXXVoguestockingscouplewife

• 06:02 thumb_up 87%

  Adorable lady pleasures her hairy pussy until she squirts

  1 year ago

  XXXVoguehuge dildo

• 08:14

  This Slut Gets Fucked by a big fake penis to ejaculation

  1 week ago

  HDSexlesbianmachineorgasm

• 22:53 thumb_up 83%

  Stepfather gobbles my vag while mom is at the shops I get so wet from his intense eating

  4 weeks ago

  MatureClubmomebony

• 15:48 thumb_up 79%

  Deutsche retro pornos! Feuchten dreier! Deutsche mamas zeigen wie es geht!

  3 years ago

  VideoSectionfistingvintagegerman

• 05:39 thumb_up 67%

  Caught Her drilling Hairbrush! but We Used Cucumber as double fake penis!

  2 months ago

  VideoSectioncaughtbritish

• 27:24 thumb_up 71%

  Lesbians finger each others wet cooters

  6 months ago

  VideoSectionlesbianmaturesoloteen (18+)

• 22:10 thumb_up 58%

  Steamy POV of a voluptuous BBW milf with a huge, juicy ass peeing, squirting, and getting filled up

  1 month ago

  XXXVoguepussypissingblackBBWfatchubby

• 07:29 thumb_up 78%

  Only Taboo - mature trailer

  2 years ago

  OkXXXgrannyshower

• 07:40 thumb_up 90%

  Only Taboo - striptease clip

  2 years ago

  OkXXXorgasmgrannyczech

• 28:28 thumb_up 54%

  His wristwatch disappears into the beaver crevasse of his corded aunt

  1 year ago

  MatureClubgermanfistingbondagedouble anal18tiedvintage

• 08:14 thumb_up 85%

  Lp-151 Kandy Gets engulfed

  1 year ago

  MatureClublesbianmuscleorgasmBBWBDSMlatinaclit

• 25:45 thumb_up 50%

  Young girl and her friend have a all girl escapade and reach climax at the same time

  7 months ago

  VideoSectionlesbianbig titsorgasmhairyold and young (18+)

• 29:53 thumb_up 90%

  Elderly and youthfull slurp the jade box

  11 months ago

  HDSexlesbianchubbybritishnipplessmall titsfingering

• 15:16 thumb_up 83%

  Skinny teen puts smallish dildo in her mini crevice

  3 months ago

  VideoSectionmaturesoloskinny

• 1:25:48 thumb_up 61%

  Pumped Monster Cunts

  4 years ago

  UporniaMILFhairymonsterlesbian

• 06:33 thumb_up 75%

  Watch my cunt very close while fucking!

  4 years ago

  xHamstergerman

• 06:46

  MILF’s ass fucking opening up fantasy Part 1: Jeweled Plug Tease & Orgasm

  1 week ago

  HDSexfistingstockingsanalass to mouthasslingerie

• 06:15 thumb_up 86%

  Eveline Magic gets her old hairy senior cunt examined

  4 years ago

  xHamsterdoctorhairyczechexammachine

• 24:44 thumb_up 43%

  Hot wife fucks machine and cock in the sun while sunbathing

  1 year ago

  XXXVoguemachinefisting

• 06:04 thumb_up 87%

  Magnificent cougar gets to relieve on mothers day and have her pussy devoured

  8 months ago

  MatureClubhomemadeorgasmamateur

• 08:21 thumb_up 50%

  I find my neighbors fucking loudly and jerking fingering my mouth-watering vagina

  10 months ago

  HDSexitalianhomemadesolo

• 05:53 thumb_up 71%

  Amateur couple shares a steamy mutual masturbation session and both explode with pleasure

  3 months ago

  XXXVogueorgasmmutual masturbationcouple

• 17:06 thumb_up 64%

  DAD’S five INCHES vs SON’S 8! Stepmom’s coochie covets Deeper Creampie!

  3 months ago

  VideoSectioncheatingstepmomcreampiemonstersurprise

• 30:08 thumb_up 60%

  Unconventional lesbian encounter between mature BBW and petite teen girl scout Anna Paige

  1 year ago

  XXXVoguegerman

• 05:44 thumb_up 50%

  Horny mature BBW with big booty enjoys intense fuck session

  1 year ago

  XXXVoguemachinegranny

• 05:15

  BBW MILF has intense pussy rubbing orgasm solo session

  1 year ago

  XXXVoguebareback

• 07:14 thumb_up 58%

  Showing off my pussy on a beach in front of strangers

  1 year ago

  XXXVoguestrangerflashingwife swap

• 1:00:55 thumb_up 50%

  Housewife surprises her husband with hot sex

  1 year ago

  xHamsterwifehousewifeswallow

• 05:14 thumb_up 40%

  Arse Clapping supersized big beautiful women Can Still Make Her Old Cunt Cum Load

  7 years ago

  Analdingrannywetwebcam

• 27:49 thumb_up 61%

  Two horny grandmothers get lesson in cunt fucking

  3 years ago

  xHamstermassageorgasmsaggy titshardcorejapanese uncensoredjapanese massage

• 16:49 thumb_up 88%

  Cougar With Big Cunt Lips And Huge Clit Has Two Incredible Self Filmed Orgasms

  4 years ago

  Analdinclitmasturbationwetbig clitfingeringhomemade

• 26:55 thumb_up 68%

  Creepy granny offers her cunt for a young cock

  3 years ago

  xHamstermaturegermanorgasmlingeriedoggingfacialriding

• 14:31

  Husband getting my cunt on a cruise ship

  3 years ago

  xHamsterdressthong

• 17:04 thumb_up 81%

  Compilation of women climaxing and squirting everywhere - amateur Lanreta

  1 year ago

  XXXVoguesquirtorgasm compilation

• 35:02 thumb_up 75%

  Kim Cums & wonderful Charlie Forde In steamy lezzy Shoots!

  1 month ago

  HDSexorgasmlesbiankissing

• 06:23 thumb_up 90%

  Horny stepsister pleasures herself in the shower

  1 year ago

  XXXVoguearabescort

• 20:41

  Obedient hoe does everything you want

  2 days ago

  HDSexmasturbationsologermanass to mouth

• 05:16

  Amateur wife explores her tight pussy with her toys for the first time

  1 week ago

  XXXVoguestockingshairysolohandjob

• 14:33

  He convinced his wifes friend to get off to her red lingerie before he took her for a ride! Featuring real talk!

  2 days ago

  XXXVoguemomrussiandirty talkcreampiehandjob

• 47:26 thumb_up 58%

  Mature woman enjoys outdoor pussy licking with a stranger in the cornfield

  1 year ago

  XXXVoguefull moviegermanhomemade

• 28:53

  Mature teacher resembling a teen rides her student

  1 year ago

  XXXVogueskinnyteacherhairy

• 29:54 thumb_up 77%

  Curvaceous chinese milf with Bushy Pussy teach Boy how to Fuck an let im Cum inside in Uncensored Japan Porn

  5 months ago

  MatureClubswingercoupleasianorgasmjapanesechinesehousewife

• 14:44 thumb_up 86%

  Stepmother and Stepdaughter Jerk off and Lick Their Cum-filled Cunts and get ...

  7 months ago

  Beegcreampiedildolesbianmom

• 06:11 thumb_up 82%

  Fisting real wife turned slave after she begs for orgasm by oinking - goonette gets release after 3 hours of edging

  3 years ago

  xHamsterfistingdirty talk

• 32:13

  Mom domme showcases father where the rabbit is running

  10 months ago

  VideoSectionfull moviegrannyass lickingmatureBDSMgerman

• 31:07 thumb_up 43%

  Horny mature woman enjoys sensual vacation massage and steamy camera play by the fireplace

  1 year ago

  XXXVoguevacationhomemade

• 33:09 thumb_up 64%

  OMG! I am cumming again! your tongue is too deep inwards my fat fat pussy, it’s driving me nuts, hot old grandma sharing bed, pov

  4 months ago

  HDSexblackfatcreampiebig assgrannychubbyorgasm

• 19:07 thumb_up 79%

  CreamPie – 50yo coochie 2 hatch mummy GILF

  10 months ago

  HDSexcreampieswingercouplewifecuckoldass to mouthglasses

• 40:14 thumb_up 69%

  Slutty redhead Lovemealots gets her big pussy licked and takes a pounding for multiple orgasms

  1 month ago

  XXXVoguematureamateurcreampiemoneycouplerussianbig tits

• 44:59 thumb_up 87%

  Seductive stepmom Alexis Fawx lusts after stepdaughter Carter Cruises sweet pussy in frisky mommy-daughter affair

  1 year ago

  XXXVoguelesbian seductionlesbian

• 06:20 thumb_up 70%

  Unexperienced blonde Mature Wife Enjoys Sex After walking

  1 month ago

  VideoSectionamateurfeetstockingscreampiegermannylon

• 25:15 thumb_up 50%

  Hot secretaries Kittina Clairette, Subil Arch, Kira Queen, and Kiara Lord in heels and glasses ready for some wild office action

  2 weeks ago

  XXXVoguesecretarystockingsglasses

• 09:43 thumb_up 68%

  Deep pleasure in cherry hole – I unleash my explosion while she begs for more

  4 months ago

  XXXVoguehairygrannyorgasmBBWmatureclose up

Categories

Other free porn sites