Mature • Cum Inside 19,856 videos

• 07:59 thumb_up 71%

  Creampie Stepmom And Granny Make Deep Blowjob And Fuck Boys

  4 months ago

  uAnalgrannygranny analteen (18+)old and young (18+)stepmom

• 02:13 thumb_up 93%

  Turbo creampie in the public outdoor pool! l DADDYS LUDER

  4 years ago

  xHamsterpublicgermanflashing

• 07:13

  Mature biz girl prays for his cum inside her - total sequence - mom xxx

  2 days ago

  Sexuczechmatureorgasm

• 07:01 thumb_up 79%

  I love to feel how his semen pours into my tight pussy!

  2 years ago

  xHamsterbabecreampiehomemadeorgasmwife

• 03:05 thumb_up 83%

  Very fast bareback sex ends as cheating slut wife impregnation creampie! - Milky Mari gets a fast balls deep creampie

  3 years ago

  xHamsterbareback

• 38:02 thumb_up 65%

  StepMom Let Me Fuck Her Secretly So Her Husband Wouldn't Find Out! vol.2 - Part.2

  2 years ago

  xHamsterhusbandstepmom

• 10:32 thumb_up 70%

  Mature NL - fingering movie

  2 years ago

  PornHatgranny analGILF

• 06:40 thumb_up 66%

  Very close to my wet pussy i need big inside deep

  3 years ago

  xHamstergreekspycaughthomemade

• 08:12 thumb_up 87%

  Just Fuck Me Hard and Fast Deep Inside My Juicy Pussy, Best Sex Ever, Fill Me up with Cum, BBW Riding

  1 year ago

  xHamsterbig assgrannyinterracialridingclose uppussyPAWG

• 08:12 thumb_up 56%

  This Asian Grandma Cannot Stop Shaking as He Thrusts and Nuts Deep Inside Her Cunt

  2 years ago

  xHamstergranny analjapanese lesbiancreampie

• 05:38 thumb_up 76%

  Big Butt Cheating Wife Furious When Lover Cums Inside Her Tight Pussy Accidental Creampie

  3 years ago

  xHamsterPAWGcreampiehomemade

• 39:25 thumb_up 89%

  Sexy Japanese Mother seduce her Classmate to Fuck and cum inside her Pussy

  2 years ago

  xHamsterMILFjapanese momjapanese uncensoredasianmature

• 07:18 thumb_up 70%

  Step Daddy tries to bang both daughters hard and ends up cumming inside Aliya Brynn and Jackie Rogen

  2 years ago

  Sexugrandpa

• 18:43 thumb_up 64%

  HOMEMADE ROMANTIC PORN - HORNY STEPSISTER... I CANT TAKE IT ANYMORE, IM NOT WEARING PANTIES, LETS drill AND cum inside

  6 months ago

  HDSexhomemadeorgasmamateurpantiescreampie

• 08:00 thumb_up 64%

  She Keeps Sucking Off After I Cum Inside Her Mouth - Verified Amateurs

  10 months ago

  KePorncreampiecum in mouth

• 03:02

  CUM I ME, CUM IN ME, PLEASE

  3 years ago

  xHamstercreampie

• 19:28 thumb_up 86%

  Asian Milf Fucked Hard On The Beach In Sundress Creampie Orgasm

  4 weeks ago

  TheyAreHugeasianamateuroutdoorbeachorgasmcreampie

• 05:09 thumb_up 71%

  Young Girl Tight Pussy Fucked By Her Boss's Son - Cum shot Inside

  2 years ago

  xHamsterindonesian

• 21:58 thumb_up 54%

  Big Tits Stepsister Gives Big Titfuck Stepbro Then Rides His Dick He Cum Inside Her While Her Bouncing Boobs Big Ti

  3 years ago

  xHamsterteen (18+)

• 13:24 thumb_up 71%

  14 Guy cum inside 1 german latina milf and make her creampie

  4 years ago

  xHamstergangbanglatina

• 08:00 thumb_up 86%

  Stepmom Breaks Foot & Needs Stepson

  11 months ago

  KePornmature

• 01:34 thumb_up 65%

  Pervert Files: Sierra

  8 months ago

  uAnalsquirtanalpissingcreampie

• 07:59 thumb_up 77%

  Hubby Shares His Wife For A Third Time

  11 months ago

  KePornblowjob

• 06:59 thumb_up 83%

  Stepmama Obese Natural Large Titties Stepmother Id Like To Fuck Likes To Play With Younger Guys Large Rod

  3 months ago

  PePorncreampiemommaturenaturalbig tits

• 08:00 thumb_up 60%

  Charli Adams And Jana Nelle - Old Sex Party

  8 months ago

  uAnalmomanalgroupcreampiebritishparty

• 21:02 thumb_up 61%

  Free Using My Step Mom and Step Sister Aaliyah Love & Reese Robbins and Cum Inside Them - Usepov

  1 year ago

  xHamstersmall titslesbianmomFFM

• 05:42 thumb_up 72%

  My girlfriend's grandmother riding his cock when she's not around and she likes to be finished doggystyle

  2 years ago

  xHamstergrannylatina

• 05:22 thumb_up 76%

  Mature MILF Kamasutra Riding Cum Inside

  9 months ago

  $$ FapHousegrannysaggy titscougarcouplematureriding

• 09:03 thumb_up 60%

  Handjob fast In the naturist beach while there were people next to us.

  2 years ago

  xHamsterbeachnudist

• 22:11 thumb_up 66%

  Hot orgy with partner swapping and unprotected creampie sex

  2 years ago

  xHamstercreampieorgywife swapfoursomehomemade

• 08:00 thumb_up 79%

  Best Porn Video Teen 18+ Will Enslaves Your Mind - George Uhl And Lady Bug

  8 months ago

  Teen21momcum on pussyhairycreampie

• 14:59

  Mom XXX - fingering scene

  5 days ago

  PornHatwifefeetmature

• 08:00 thumb_up 88%

  Amateur Wife Has 1st Double Penetration In Hotel

  7 months ago

  uAnalwifeorgyorgasm compilationcompilation

• 37:30 thumb_up 62%

  StepMom Wants Me to Cum Inside Hot MILF Creampie Collection

  1 year ago

  xHamstercreampiePOVMILFcheatingcreampie compilationcompilationcumshot

• 07:59 thumb_up 88%

  Chubby Amateur Milf Gets A Big Dick Creampie - Big Dick

  5 months ago

  PePorncreampiemom

• 10:58 thumb_up 84%

  Dont Cum Inside Im Married! Milf Wife Creampied after Party

  11 months ago

  Beegmasturbationcreampiecouplewifekissing

• 1:00:55 thumb_up 50%

  Housewife surprises her husband with hot sex

  1 year ago

  xHamsterwifehousewifeswallow

• 05:27 thumb_up 75%

  Cam my wife getting big cumshot from her boss on her tits

  4 years ago

  xHamsterhandjobmomhiddencuckoldspy

• 08:00 thumb_up 67%

  Stevie K In Creamed By Her Stepson

  11 months ago

  KePornpantiessolocreampie

• 07:59

  Hotwife Sommers Takes Dfw Big And Cumload - Mary Lou

  11 months ago

  KePornswinger

• 05:29 thumb_up 71%

  Sperm is the best lubricant. Cum inside several times for a better glide

  2 years ago

  xHamstergermanBDSMhomemadeBBW

• 19:17 thumb_up 89%

  I'm Your Step Mom! Don't Cum Inside Step Mother! Step Son Cum Twice: on Face, in Pussy - Kisscat

  1 year ago

  xHamstercreampiebondageBDSMfacialtiedbig cockmissionary

• 05:43 thumb_up 61%

  I will ride your cock without a condom, so please try dont cum inside my fertile pussy, okay? - Milky Mari

  1 year ago

  xHamsterBBWchubbyhomemadeamateurwifepregnant

• 09:41 thumb_up 88%

  Jizzed And Cream Pies Son Cums Inside Redhead Step Mom

  3 months ago

  TheyAreHugemomcreampiestepmomcumshotbig cockcum on pussy

• 08:00 thumb_up 86%

  The Cum Inside Me Its Between Us, Stepdaddy

  6 months ago

  KePornlesbianmature analhomemadeteen anal (18+)

• 07:59 thumb_up 90%

  Black Coco - Gangbang With Black Housewife Coco And 21 Guys

  7 months ago

  PePornorgygangbangwifecreampiemature

• 12:53 thumb_up 68%

  Silver Fox Ann Is A Very Sexy Milf Gilf with great Feet

  1 year ago

  xHamstermomfeetcreampiegrannycougarassaunt

• 10:17 thumb_up 55%

  Mature NL featuring escorts feet porn

  2 years ago

  PornHatsmall titsmature analcreampie

• 08:00 thumb_up 81%

  Usa - Ugly Mature Anal

  9 months ago

  uAnaluglyanal

• 08:00 thumb_up 72%

  My Best Friends Cums In My Hairy Wife

  11 months ago

  KePornteen anal (18+)

• 07:18

  Huge Tits blonda milf cum inside - utter scene - Dane Jones

  2 weeks ago

  Sexuasscreampie

• 08:00 thumb_up 71%

  Cleaning For Extra Money

  10 months ago

  KePornmoneyhomemade

• 12:55 thumb_up 77%

  Womens creampie scene

  3 years ago

  OkXXXcreampiejapanese momjapanese uncensoredmomhairy

• 08:00 thumb_up 80%

  Riley Jacobs - Brunette Housewife Can Handle A Monster Bbc

  8 months ago

  uAnalBBChousewifehomemade

• 08:00 thumb_up 88%

  Horny Cheating Wife Fucks The Plumber - Cuckold Husband Creampie Cleanup

  8 months ago

  KePornwife swapcuckoldplumber

• 38:33 thumb_up 84%

  Stepmom will definitely allow you to cum inside

  5 years ago

  TXXXcreampiestepmomfantasy

• 06:02 thumb_up 73%

  Close up creampie Desi Kolkata bengali boudi open her pussy hole with both hand and takes cum inside

  1 year ago

  xHamstercreampieskinnytight

• 04:27

  Let me pee on your dick before I sit on it. Please cum inside me. Dripping creampie. Close-up.

  3 years ago

  xHamsterclose up

• 07:59 thumb_up 56%

  Married Older Women, Are More Willing To Let You Cum Inside Them When The Husband Is Away For Work.-3

  5 months ago

  xMILFcuckoldcastingasianhusbandjapanese uncensored

• 15:26 thumb_up 67%

  I M GONNA CUM, OMG NO, Please hurry up and fuck me but dont cum inside my pussy, too late You make me cum, my cock is empty

  1 year ago

  xHamsterhomemadearabfatinterracialcheatingbig titsupskirt

• 10:27 thumb_up 72%

  Milf boy clip with comely mademoiselle from Mature NL

  2 years ago

  PornHatmaturecreampielesbian

• 07:01 thumb_up 75%

  Young Black Guy Has The Honor To Fuck Red Haired Mature Woman With Andi James

  7 months ago

  Teen21creampieteen (18+)

• 12:33

  Cumming Raw in Wife's Creamy Pussy while She's Ovulating Creampie

  2 years ago

  xHamsterhomemadecreampiewifeorgasmnaturalbig clit

• 09:59 thumb_up 83%

  CZECH WIFE SWAP 8/3 (Did you cum inside me?)

  6 years ago

  PornHatcreampieczechpantieswife swap

• 05:15 thumb_up 88%

  My Spouse With A Short Jock Cum Heavy Creampie On My Cheating Snatch After Team Fuck Sex

  5 months ago

  PePornBBWmomfatmuscle

• 07:59

  While My Stepson Was Playing With His Friends At The Public Pool For 8 Hours, I Was Having An Affair With The Coach Of His Swimming Lessons With Mina Kitano And Kitano Mina

  3 months ago

  KePornpoolmatureasian

• 14:48

  Pussy Cumshot Sexy Fit Housewives Stretched Felt Up And Fucked - COMPILATION

  5 days ago

  TheyAreHugecumshot compilationcreampie compilationcreampie

• 08:00

  Incredible Adult Clip Step Fantasy New Full Version

  1 week ago

  PePornbig cock

• 08:00 thumb_up 70%

  18yr College Boy Cums After 3seconds Inside Ebony Mystique Creamy Wet Pussy In Unexpected Surprise Creampie

  3 years ago

  BlackPornTubefunnysurprise

• 10:34 thumb_up 84%

  My tight pussy is stretched and loaded with sticky hot cum in missionary position!

  4 years ago

  xHamstercreampie

• 08:00 thumb_up 92%

  Maman Bourgeoise Enculee Dans Une Cave De Cite Sans Capote

  8 months ago

  PePorncreampiemom

• 08:00 thumb_up 63%

  Stepmother Explains Anal Sex To Her Stepson - Full Anal Creampie - Hawt Filthy Talk - English Subtitle

  7 months ago

  uAnalfrenchamateurbritishcreampie

• 08:00 thumb_up 40%

  A Stepmother Fucked Her Stepsons Classmate - Alina Rai

  7 months ago

  Teen21homemade

• 08:00 thumb_up 57%

  Busty German Blonde Opens Her Pussy And Her Ass For A Double Penetration In A Wild Threesome To Feel Pleasure With Petra Wegat

  4 months ago

  uAnaldouble penetrationcreampiegerman

• 05:07 thumb_up 80%

  Cougar Gets Creampie By Younger Monster Bbc

  6 months ago

  PePorncreampieBBWinterracialBBCmonster

• 19:22 thumb_up 92%

  Carmen T - I Wanna Cum Inside Your Grandma #06

  5 years ago

  Uporniacreampiebig assgrannyhairybig cock

• 08:40 thumb_up 79%

  Cumming Inside My Moms Best Friend on Vacation - Momcomesfirst - Alex

  6 months ago

  Beegmomvacationfrenchcreampie

• 12:51 thumb_up 77%

  Open mind step mother caught me masturbating and helped me to cum inside her

  3 years ago

  xHamstercaught

• 08:00 thumb_up 75%

  She Took Those Big Black Cocks In Every Hole And The Cuckold Cleaned Up With Danny Blaq

  10 months ago

  KePornorgycuckold

• 10:38 thumb_up 73%

  Modest Asians natural tits trailer

  3 years ago

  OkXXXjapanese uncensoredjapanese

• 08:00 thumb_up 57%

  Getting All She Could Handle

  10 months ago

  Fuxxxinterracialmomhairycreampie

• 20:15 thumb_up 57%

  Stranger found the key to my house, made his way inside and creampied my pussy (Role playing)

  2 years ago

  xHamsterBBWhomemade

• 24:30 thumb_up 88%

  Four dudes move dicks back and forth inside a mature lady

  8 years ago

  Analdinnaturalgangbang

• 10:00 thumb_up 83%

  CZECH WIFE SWAP 8/2 (Cum inside me, you old bastard!)

  6 years ago

  PornHatcreampiewifeczechsleepingwife swap

• 05:08

  Compilation Fuck and creampie in my pussy and ass slut cum in mouth and face of whore Tina empty balls French Toulouse

  1 year ago

  xHamsterfrenchcum in mouthhomemadecumshot compilationamateurcreampie compilation

• 08:11 thumb_up 63%

  'I Want You To Cum Inside My Pussy, Please Fill Me Up!' Mature MILF having multiple orgasms, loves fucking in front of t

  3 years ago

  xHamstercreampie

• 06:44 thumb_up 63%

  Oops sharing a bed with my granddaughter's boyfriend ends in an unexpected creampie.

  2 years ago

  xHamsteraccident

• 08:08 thumb_up 80%

  Please Cum Inside Me! Step Mom Wakes Up to a Hard Dick of Her Step Son

  1 year ago

  Beegmomsmall cockvoyeurcreampieMILForgasmreality

• 08:00 thumb_up 50%

  Japanese Stepmother With Miki Yoshii And Yoshii Miki

  11 months ago

  KePornjapanese mom

• 08:12 thumb_up 75%

  Southern White Pussy

  1 year ago

  xHamsteramateurmature

• 49:06 thumb_up 78%

  Big Dick Yayoi Likes BBC - Mizuki Yayoi

  5 months ago

  TheyAreHugeblackcreampieinterracialasianjapanesebig cockBBC

• 31:48 thumb_up 90%

  Husband cuckold likes to see his wife fuck another man and let him come inside her pussy

  4 years ago

  xHamstercreampiecheatingcuckoldass licking

• 07:59

  Incredible Adult Movie Japanese Uncensored Incredible Just For You

  1 month ago

  PePornjapaneseasianjapanese uncensored

• 13:45 thumb_up 87%

  German Taboo Secrets 12 (Cum Inside Me Grandpa)

  6 years ago

  Uporniacreampiegrandpafantasy

• 07:28 thumb_up 87%

  Hot Body MILF takes Butt Pug and Fucking till She Cums.

  2 years ago

  xHamsteramateurmomhomemadeanalcreampie

• 10:50 thumb_up 93%

  Leilani Leis breeding creampie video by Danny Oceans Adventures

  3 years ago

  PornHatcreampiemissionaryinterracial

• 06:54 thumb_up 72%

  Verified Amateurs - Office Quickie

  10 months ago

  KePornquickie

• 07:12 thumb_up 85%

  Public freefuck with mega creampie!

  1 year ago

  xHamstercumshotgermanpublic

• 05:06 thumb_up 50%

  My Cheating Wife With Big Pregnant Belly Showing Me Her Creampied Hairy Pussy - Milky Mari

  5 months ago

  PePornpregnantcuckoldcreampiefat

• 08:00 thumb_up 73%

  Hot Horny Sexy Big Ass Ssbbw Cheating Wife Fucks Plumber Doggystyle & Missionary As Payment For Work Done (point Of View

  6 months ago

  FuxxxinterracialdogginggrannyBBWpussy

• 08:00 thumb_up 92%

  Stepmommys Boy Horny Milf Is Almost Caught Giving Stepson A Morning Snack Full Bulgaria - Karen Fisher And Rene Bond

  6 months ago

  KePornfootjobwifehomemademominterracial

• 11:24 thumb_up 83%

  Gynecologist fucks his old client during vagina check and cums inside

  2 years ago

  AnySexgermanmature analcreampie

• 45:37 thumb_up 94%

  Accidentally Cum Inside My Very Busty Stepmom In The Hotel Room

  5 years ago

  HDZogcreampieold and young (18+)hotelmature

• 08:00

  Nnn Challenge Day 21 Cum Inside Make Stepmommy A Stepmommy

  9 months ago

  KePornhousewifehomemade

• 15:16 thumb_up 44%

  I am fucked first time by a village bull and cum inside my pussy.

  1 year ago

  xHamsterspankinggranny

• 07:41 thumb_up 67%

  Big boobed patient Sonny Mckinley gets fertility test in the medics office - weirdo doctor

  11 months ago

  Sexudoctorofficeexamanimecum in mouthbathroom

• 05:32 thumb_up 55%

  MILF granny fucking sideways and sucking cock wants the cum left inside her

  2 years ago

  xHamsterBBWgranny analgerman

• 08:00 thumb_up 94%

  Stacie Gets Her Boy Ready For A Date - Small Tits

  5 months ago

  Teen21small cockfetish

• 08:00

  Sex Starved Milf Lets A Young Man Blast His Load Inside Her Butthole - Anal Creampie

  8 months ago

  Teen21teen anal (18+)mature anal

• 07:45 thumb_up 60%

  Granny Pixie: He Made My Pussy Drip Cum. 01152023 CAMS126

  2 years ago

  xHamsteramateurwifecreampiegrannylingeriemissionary

• 07:36 thumb_up 67%

  Oh My God I Am Gonna Cum, No, Pull Out I Am Still Able to Get Pregnant, Please Dont Cum Inside Me

  1 year ago

  xHamstergrannychubbyinterracialpregnantcumshotheels

• 19:31 thumb_up 93%

  Fine-looking Maggie Moons auntjudysxxx video

  2 years ago

  PornHatmatureamateurcreampiebritishstepmomfantasypussy

• 07:29 thumb_up 69%

  Mummy fabulous natural woman with Hairy Pussy gets cum inside after hot 69

  9 months ago

  HogTVorgasmhairy

• 08:00 thumb_up 60%

  576 Uncensored Model Gets Unwanted Fuck

  11 months ago

  KePornjapanese momjapanese uncensored

• 17:19 thumb_up 70%

  Luring hookers mom dirt

  1 year ago

  PornHatblowjobcreampieasianhookerjapanesejapanese momsmall tits

• 07:59 thumb_up 79%

  Saggy Milf Gets A Bbc Creampie With Psilo Siren

  6 months ago

  KePornbrunetteinterracialbig cockcreampieBBC

• 07:57 thumb_up 78%

  Lad fucks girlfriends mom and cums inside her fat ass

  5 years ago

  XBabecaughttitjobbrunette

• 08:00

  Granny Massachusetts: Chicopee Class Of 1972 Angel Now Gilf Stick & Dick Creampie 3 3 2024 Cams12345

  6 days ago

  KePornhomemadegrannyBBWGILF

• 05:08 thumb_up 56%

  Syrian Refugee Cleaning Maid Lets German Boss Cum Inside Her Vagina

  2 years ago

  xHamstergerman

• 23:12 thumb_up 80%

  Experienced milf wears lingerie while banging the stud and making him cum inside her stockings

  2 years ago

  xHamsterstockingscreampielingeriedeepthroatheels

Categories

Other free porn sites