Mature • Cum In My Pussy 5,962 videos

• 54:12 thumb_up 79%

  100% Reel anal: I transformed my little French granny into an anal slave..

  1 year ago

  xHamsterhomemadefrenchmature analanalcuckoldcum in mouthpussy

• 22:12 thumb_up 79%

  Married Slut gets a Hard Fuck Deep in her Throat and a Huge Cumshot in her Fucking Mouth!

  8 months ago

  xHamstermomwifeMILFcheatingbig titsbig cockcum in mouth

• 28:07 thumb_up 49%

  Please slow down, I dont want you to cum in my still fertile pussy, i might get pregnant, is that your sperm flooding my inside?

  9 months ago

  xHamsteramateurmomhomemadearabfatcreampiemature anal

• 11:31 thumb_up 81%

  I Cum In My Hairy Mom - Teen

  2 years ago

  xTitsmomhomemadeblowjobgermanwifehairypussy

• 27:52 thumb_up 71%

  Stepmommy's Boy is Back

  4 years ago

  xHamstermaturemomcreampiecum in mouthpussy

• 06:05 thumb_up 77%

  Stepson fucked his stepmother right in the kitchen

  2 years ago

  xHamsterMILFupskirtsurprisekitchen

• 31:51 thumb_up 74%

  30 MINUTES OF BEST CUMSHOT !!! Part 4

  1 year ago

  xHamsterhandjobamateurhomemadeblowjobbig titscompilationcumshot

• 02:57 thumb_up 65%

  Ooh yes fuck me harder in my ass & cum inside slam your cock in me deep oooh i am having a orgasm my cunt & my ass

  3 years ago

  xHamstergrannyorgasm compilationcompilation

• 15:55 thumb_up 63%

  Fucking My Wife in Honeymoon Night Cum in Pussy Creampie Dripping Wet Pussy

  1 year ago

  xHamstermaturehairybig titsnaturalpussyjapanese uncensoredbrunette

• 20:38 thumb_up 79%

  Mature wife fucked in her ass by strange guy at porn casting

  3 years ago

  xHamstercastingmomgermanmature analanalwifecheating

• 28:05 thumb_up 88%

  Mom Wants My Cum In Her Panties

  6 months ago

  TheyAreHugedoggingmissionarymombig titspanties

• 33:02 thumb_up 74%

  If you want to bake a cake, you need protein

  3 years ago

  xHamsterfrenchanalMILFass to mouthcum in mouthkitchen

• 06:14 thumb_up 60%

  I let my acquaintance fuck my wife in pussy and he slightly pull out his cock at the end of fucky-fucky and almost cum in her -Milky Mari

  10 months ago

  MatureClubhomemadecreampiewifehairybig titscuckoldhusband

• 05:29 thumb_up 74%

  Voyeur in the car on a rest area, I jerk him off with my breasts, empty his balls, he uses me like a whore and squirts in my mouth

  1 year ago

  xHamsterpublicvoyeurcarswallowfrenchcum in mouth

• 22:53 thumb_up 74%

  Hot wife gets satisfied by her neighbor

  1 year ago

  xHamstergermanwifebig clitseducedneighbor

• 28:59 thumb_up 90%

  Beautiful chubby mom porn perverted story

  6 months ago

  XoZillamomfatcreampiebig asschubbyMILFBBW

• 05:43 thumb_up 82%

  Showing Her Hairy Pussy My StepSister Offered to Jerk Together. Handjob before bed. Cum in panties.

  3 years ago

  xHamsterhandjobfrenchhairyjerkingmasturbationpantiesold and young (18+)

• 30:47 thumb_up 77%

  My husband watched me fuck other men in a swing club I got my asshole and my pussy all open, hard sex

  3 years ago

  xHamsterswingercuckoldorgyclubwatchingBBC

• 20:36 thumb_up 88%

  Costas gives his favorite mature neighbor a huge facial - German retro

  3 years ago

  xHamstergrannyhairycum in mouthvintage

• 12:46 thumb_up 77%

  VenusetVulcanus! Stepmother fucking Stepson when he studying

  1 year ago

  xHamsterswingerhomemadefrenchcum in mouth

• 06:40 thumb_up 66%

  My Pussy Gonna Cum, Hurry up and Bust Your Nut Now! Horny as Fuck, Huge BBW Shower

  10 months ago

  xHamsteramateurfatgrannyorgasmBBWcaughtshower

• 06:09 thumb_up 77%

  Stepmom milf saggy tits riding my big cock till i cum in her pussy fetish taboo

  2 years ago

  xHamstermaturemomfemdomteen (18+)creampieanalteen anal (18+)

• 04:42 thumb_up 63%

  Desi Angel - I seduce my husband's best friend and he follows him with a hidden camera

  3 years ago

  xHamsterhiddenhairycum in mouthseduced

• 12:52 thumb_up 89%

  My Wife Begged for Creampie after BBC gave her Leg Shaking Orgasms

  6 months ago

  SunPornoamateurcreampieinterracialwifeorgasmbig cockass

• 12:49 thumb_up 77%

  Hookup with my sisters beau in the end he cums on my breasts lexly_16 & magoculionero

  2 months ago

  VideoSectionhomemadecuckoldcum in mouthmissionarybig assgirlfriend

• 06:51 thumb_up 90%

  Stuck my dick in my stepmother's pussy while she wasn't expecting it

  2 years ago

  xHamstersatinmature

• 22:22 thumb_up 92%

  My hot stepmother caught me wanking....

  3 years ago

  xHamstermaturemomMILFbritishstepmomswallowblonde

• 1:07:19 thumb_up 77%

  Bang my wife! Extreme Sperm and Piss Bareback-Gangbang! Full Movie

  3 years ago

  xHamsterpissingsquirtwifespermswallowgangbangfull movie

• 08:33 thumb_up 86%

  My ex-girlfriend gave me her pussy to get a good portion of creampie.

  8 months ago

  xHamstermissionaryhairycreampieclose upgirlfriend

• 05:34 thumb_up 83%

  First I was allowed to come, then he satisfied himself in me

  1 year ago

  xHamsteramateurhomemademasturbationhairywifecum on pussy

• 10:07 thumb_up 76%

  Please dont Cum in my Pussy! Married Mature MILF with Big Ass Cheating in Bathroom

  2 years ago

  xHamsteramateurmommature analanalcheatingitalian

• 07:53 thumb_up 81%

  Shopping Sucks...So I Did Both!

  2 years ago

  xHamsterblowjobswallowcum in mouthslut

• 33:14 thumb_up 80%

  MATURE MOM Gets Even With Son by Fucking his Best Friend!

  2 years ago

  xHamstermatureMILFbig titscum in mouthmom

• 32:13 thumb_up 73%

  Retirement home caretaker loves threesomes with the grannies

  3 years ago

  xHamstermaturegermanvintageswallowgranny

• 05:04 thumb_up 76%

  I came to visit my mother-in-law and fucked her and finished twice close up

  2 years ago

  xHamstermaturecreampiemother in law

• 21:51 thumb_up 79%

  Fucked my best friend's MILF mom and cum in her pussy

  9 months ago

  xHamsteramateurmomhomemadecreampiePOVpartyrussian

• 18:22 thumb_up 78%

  I help my stepsister clean the dining room and we end up fucking on top of him

  2 years ago

  xHamsterbisexualdildoass lickingfingeringcum on pussymasturbation

• 06:34 thumb_up 81%

  Anal sperm dripping out of asshole and anal cum fart compilation

  11 months ago

  xHamstercreampie compilationcompilationspermassclose upcumshot compilationgranny anal

• 02:44 thumb_up 68%

  Love Getting My Pussy Eaten While Swallowing Cum

  2 months ago

  PornGemhomemadepantyhoseswingersquirtbig assgrannyorgasm

• 14:24 thumb_up 87%

  Cuck Films Wife

  4 years ago

  xHamsterhomemadewifecuckoldswallowcum in mouthstranger

• 11:16 thumb_up 73%

  My wife ends up jerking off with my friend, cum on hairy pus

  3 years ago

  xHamstermomhiddenhairyjerkingcum on pussy

• 07:31 thumb_up 67%

  My Stepsons Friend Cums In My Mouth And Then In My Pussy

  1 week ago

  Fuxxxfatmaturecum in mouth

• 02:54 thumb_up 73%

  The First Touch of My Pussy in the Morning.

  2 years ago

  xHamstermatureamateurswingersmokingheels

• 07:11 thumb_up 79%

  The penis is all in my pussy juice and I suck it and lick it clean.He fucks me and cums inside me.

  1 year ago

  xHamsterdirty talksaggy titshairycreampie

• 31:00 thumb_up 68%

  Are you really cumming inside my pussy already? OMG that was fast! I am still gonna keep riding your cock until you cum again

  10 months ago

  xHamsteramateurhomemadefatcreampiechubbywifecheating

• 13:26 thumb_up 73%

  Stepson's friends jerk off looking and touching my hairy pussy and cum in front of me

  1 year ago

  xHamsterhomemadenyloncuckold

• 07:45 thumb_up 58%

  You'd like to fuck me like a whore and squirt in my pussy Insult me and treat me like an empty balls slut humiliate me

  1 year ago

  xHamsterfrenchwifeMILFfistingcougarslutpussy

• 29:46 thumb_up 58%

  My Pussy Gonna Pound Your Cock so Hard, It's Gonna Drive You Nuts, Oh My God, I Am Cumming Deep Inside! M

  8 months ago

  xHamsteramateurfatcreampiemature analgrannychubbyBBC

• 17:21 thumb_up 74%

  Alte Milf bekommt den Nachbarssohn zu greifen

  3 years ago

  xHamstervintageteachersaggy titscum in mouthass licking

• 05:44 thumb_up 65%

  Husband tied me up and let real stranger from Reddit cum in my pussy- TWICE!

  10 months ago

  xHamsterwifehomemadedouble penetrationtied

• 11:22 thumb_up 75%

  Oops I Creampied in My Stepmom Vol1

  2 months ago

  VideoSectionass to mouthcreampiestepmomcum in mouth

• 05:51 thumb_up 78%

  He fucks my mouth and cums on my face

  1 year ago

  xHamsterdirty talkpuffy nipplesmomcum on pussycum in mouth

• 07:21 thumb_up 79%

  Submissive Loves Dirty Talk with Facial While Fingering herself.

  3 years ago

  xHamstermomwifedirty talkswallowcum in mouth

• 07:10 thumb_up 78%

  My man drinks my golden nectar and indulges in creampie under female dominance

  10 months ago

  XXXVoguebathroomcuckoldfemdomfacesittinghomemadetoilet

• 38:44 thumb_up 69%

  Our ebony maid caught me jerking off and helped me to relief

  3 years ago

  xHamsterebonyfrenchanalmaidass to mouthcaughtjerking

• 07:19 thumb_up 65%

  My Best Friends German Mom with Big Clit Let Me Cum in Her Pussy

  6 years ago

  HClipshandjobgermanclitbig clitmom

• 07:59 thumb_up 77%

  Perverted stepbrother licks my gangbang sperm cunt and squirts deep inside

  3 years ago

  xHamstergermanspermgangbang

• 14:16 thumb_up 79%

  Having the Neighbor's Wife Over for a Gangbang

  5 years ago

  xHamsterswingerinterracialwifecum in mouthslutneighbor

• 39:25 thumb_up 77%

  As a creampie and mud fuck bitch at the next bachelor party!

  2 years ago

  xHamstercreampiespermswallowcumshotgangbangslut

• 09:20 thumb_up 88%

  Don't cum inside blindfolded stepmom! Oops step son creampied in stepmom's pussy - Kisscat

  2 years ago

  xHamsteraccident

• 17:06 thumb_up 79%

  Pussy licking. Cunnilingus. Husbands friend licked pussy wife, fucked in classic pose, cum in pussy. Creampie. Cumshot

  3 years ago

  xHamstercreampiewifehusbandclassicspermupskirt

• 26:04 thumb_up 57%

  He loves the salty taste of hairy grandma pussies - East German 80's retro

  3 years ago

  xHamsterhomemadegrannyMILF

• 13:22 thumb_up 79%

  She Wants That Black Seed

  3 years ago

  xHamstersperm

• 15:56 thumb_up 65%

  My husband came from a business trip fucked me and let all the cum into my mouth

  1 year ago

  xHamsteramateurhomemadewifekoreancum in mouth

• 31:38 thumb_up 79%

  JC picks up a hot granny for a deep and hard pussy pounding

  3 years ago

  xHamstergrannyafricanBBCpick upcum in mouth

• 03:38 thumb_up 85%

  After a long abstinence his premature ejaculation covered my pussy in hot cum.

  2 years ago

  xHamsteramateur

• 10:03 thumb_up 81%

  Please don't cum inside, My husband in next room! Cheating Wife Creampied After Party

  1 year ago

  xHamsteramateurcreampiehusband

• 18:34 thumb_up 74%

  My husband's best friend gives me a big cumshot on my hairy pussy after we masturbate

  2 years ago

  xHamsteramateurmomsmall cockwifehairycuckoldhusband

• 15:18 thumb_up 81%

  STEPMOM LICK HER STEPSONS ASSHOLE AND GETS FUCKED ANAL

  3 years ago

  xHamstermatureamateurpussymissionarymature anal

• 07:59 thumb_up 82%

  I want your CUM on my HAIRY PUSSY! I will masturbate in front of you and make you a handjob EVA MYST

  10 months ago

  xHamsterhandjobhomemadehairyjerkingmasturbationcum on pussy

• 23:56 thumb_up 83%

  Grandma only allows to fuck in her ass if she gets the cum afterwards

  3 years ago

  xHamsterhairyczechfacialhardcoregranny anal

• 20:08 thumb_up 84%

  Big young cock cums way too early in sex with experienced step mom

  2 years ago

  xHamstermomquickiecheatingsperm

• 22:18 thumb_up 85%

  Wifesharing because his wife wants to feel a big cock

  1 year ago

  xHamstermombig titsgermancum in mouthwatchinghairy

• 05:16 thumb_up 65%

  PUSSYTALK! Cum in my PUSSY!

  2 years ago

  xHamsterdirty talkJOIinstruction

• 22:49 thumb_up 81%

  Fuck My Big Hairy Pussy

  3 years ago

  xHamstercreampiehairyBBC

• 09:53 thumb_up 63%

  My Freaky ssbbw Granny

  5 years ago

  xHamsterswallow

• 27:50 thumb_up 90%

  Busty blonde milf Starla gets her tight pussy stretched by a BBC for the first time

  3 years ago

  xHamsterchubbyass lickingBBC

• 20:18 thumb_up 94%

  I AM UNFAITHFUL TO MY BASTARD OF A HUSBAND WITH MY STEPSON

  2 months ago

  SunPornobeautyanalcouplewifenaturalpantiescougar

• 18:22 thumb_up 43%

  My husband's cuckold wanted to be angry, I put him in his place, after having sex with a friend

  1 year ago

  xHamstercarhomemadedirty talkcreampielingerieMILF

• 05:14 thumb_up 58%

  French Husband Wants Guys To Fuck His Algerian Wife And Cum In Her Hairy Pussy

  11 months ago

  xHamstermatureamateurfrenchcreampieswingerwifehairy

• 05:11 thumb_up 70%

  Old lady saggy tits riding my big cock till i cum in her pussy

  2 years ago

  xHamstercreampiesaggy titsgranny analgranny

• 07:01 thumb_up 44%

  He Couldn't Control himself, So He Covered My Face With His Big Cum Loads

  2 years ago

  xHamsterblowjobgrannycreampie compilationcompilationcumshot compilation

• 25:02 thumb_up 78%

  I fuck my boss's delicious ass for the first time

  2 years ago

  xHamsterBBCbossgranny analgranny

• 16:44 thumb_up 82%

  Fuck and cum inside mouth creampie pussy whore stepmom big boob share in pov this slut milf multiple cum on stepmother b

  2 years ago

  xHamsterwifetiedcum in mouthcum on pussy

• 09:19 thumb_up 93%

  Big Pussy In My Hot Stepmom Wants Me To Cum Inside Her Big Hairy Pussy. Stepdads Not Home

  5 months ago

  HClipscreampiehairycoupleorgasmfantasystepmom

• 28:03 thumb_up 67%

  My mother in law loves to get her hairy pussy doggy trimmed - retro

  3 years ago

  xHamsterhairyass to mouthglassesmother in lawgranny

• 15:19 thumb_up 67%

  Black Guy Fucked Big Ass Horny Sexy Hot Blonde BBW Milf Mom Doggystyle (SSBBW In Pantyhose gets Cum On Pussy Twice) Nut

  2 years ago

  xHamstercreampiechubbycheatingfacesittingcum on pussy

• 20:44 thumb_up 73%

  He fucks his own grandma in the ass!

  1 year ago

  xHamsterblowjobanalgrannywetold and young (18+)pussygranny anal

• 07:45 thumb_up 51%

  Come and swallow my piss! l DADDYS

  1 year ago

  xHamsterpissingsmokingsquirtBDSMswallowcum in mouth

• 13:08 thumb_up 80%

  Please pee on my cock. Now I will fuck you and urinate inside. Wife gets an orgasm while I pee in her cunt. Close up.

  2 years ago

  xHamsterpissingsquirtclose uppussycum on pussygerman

• 03:20 thumb_up 87%

  Perv Mom Get Cum in panties by Her StepSon. She Puts On panties with My Sperm before the Family dinner.

  3 years ago

  xHamsterfetishpantiescum on pussyhomemadehandjob

• 09:18 thumb_up 72%

  I Love Riding And Feeling A Man Cum Deep In My Fertile Pussy

  1 year ago

  HClipsridingbig tits

• 11:22

  Oops I Creampied in My Stepmom Vol 3

  1 week ago

  HDSexcreampieBBWhairyorgasmstepmomteen (18+)titjob

• 06:03 thumb_up 53%

  I really like to cum on my mother-in-law's sexy thighs

  1 year ago

  xHamsteramateurpublicoutdoorold and young (18+)mother in lawmature

• 01:07 thumb_up 78%

  CUCK HUBBY PRECUMS ALL OVER BBW MILF SLUTWIFES PUSSY & THEN EATS IT FROM HER HAIRY PUSSY

  2 years ago

  xHamsterbritishdirty talkslut

• 05:24 thumb_up 77%

  REAL SEX WITH MY STEPMOM I ENDED UP CUMMING IN HER PUSSY

  3 years ago

  xHamstergrannycreampie compilationclitstepmomcompilationcumshot compilationorgasm compilation

• 11:14 thumb_up 79%

  Caught Masturbating By My Latina Milf Friends Stepmom, She Eats My Pussy And Makes Me Cum Hard In Her Bed Silvana

  2 months ago

  HClipslesbianamateurlatina

• 1:19:31 thumb_up 65%

  Hot couple fucks horny granny

  1 year ago

  xHamstergermangrannyhairynaturalpussy

• 19:40 thumb_up 72%

  Littel nasty teenie girl wants my big knob in her wet hoochie-coochie

  6 years ago

  XoZillateen (18+)creampiemature analbig titsspyfacialgirlfriend

• 19:17 thumb_up 77%

  Husband enjoys watching his busty Indian wife banged by 2 cocks

  3 years ago

  xHamsterindiananalswallowthreesome

• 06:30 thumb_up 81%

  My stepsister gives me some ultra-cute super-hot kisses, which lead to a jiggly fuck

  5 months ago

  VideoSectionamateurkissingcutecreampiecreampie compilationcompilationcum in mouth

• 23:32 thumb_up 83%

  Wow, is that a thick and huge cock! Fan blow up my holes! creampied me my cunt and cumshot me in my mouth! Full Movie

  2 years ago

  xHamstermonsterpiercingcumshotcum in mouthcreampieswallow

• 33:59 thumb_up 71%

  She was desperate for sex and she squirted as soon as I put my fingers in her pussy

  3 years ago

  xHamsterPOVswallowcum in mouthblowjob

• 16:10 thumb_up 58%

  AMATEUR GRANNY PORN: 80 YEARS OLD GRANNY GAGGING AND SWALLOWING AFTER ANAL SEX 3of3

  3 years ago

  xHamstermature analgagginghairyass lickinggranny analgranny

• 18:17 thumb_up 42%

  I knew I should not have drank the free drink sample from the stranger, it was loaded with his sperm, OMG!!!

  2 years ago

  xHamsterpissingstrangerBBW

• 15:38 thumb_up 82%

  Fuck me in the bathroom and cum in my ass

  2 years ago

  xHamsteramateuranalmaturechubbymom

• 02:24 thumb_up 82%

  At First I Was Embarrassed to Undress in Front of Camera, but Soon My Legs Were Spread Wide Open and Cum Dripping From My Pussy

  2 years ago

  xHamsterclose up

• 23:29 thumb_up 92%

  Ugly mom lets a big cock drill her asshole

  2 years ago

  xHamstermomanaloutdoororgasmuglycum in mouth

• 09:02 thumb_up 70%

  Dogging - we nail my wifey in front of the public and i pack her with cum

  5 years ago

  HogTVpublicpussy

• 05:55 thumb_up 70%

  Honey, Jerk off to My Pussy in White Panties, Lets Cum Together

  3 months ago

  $$ FapHouserussiansolohomemadelingeriejerkingpanties

• 05:43 thumb_up 85%

  Stepmom milf saggy tits riding my big cock till i cum in her pussy fetish taboo

  2 years ago

  xHamstermaturemomgrannybig cocksaggy titssperm

• 08:14 thumb_up 92%

  Meine Geile Nachbarin buttfuck Gefickt - My super-naughty Neighbor romped Anal

  6 months ago

  VideoSectionstockingsass to mouthnaturalcum in mouthbarebackneighbor

• 09:03 thumb_up 74%

  Step mom sucks and JERKING OFF at the car wash in public

  3 years ago

  xHamstercarjerkingJOI

• 19:32 thumb_up 90%

  Curvy mature Dickxy gets a load of cum on her face after anal

  3 years ago

  xHamsterfrenchcum in mouthswallow

• 11:52 thumb_up 79%

  Cuckold.! neighbor sends his wifey to my building for vegetables I send him milk in her face.����

  2 years ago

  MatureClubcuckoldcum in mouthneighbor

• 06:11 thumb_up 68%

  I make you a statement I want to fuck and reach my broom friend

  2 years ago

  xHamsterhiddenmature anal

• 01:21 thumb_up 71%

  2 Young People of 19 and 23 Years Old Fucked Me Like a Whore, One in My Ass the Other in My Pussy Until I Filled with Cum

  2 months ago

  $$ FapHousefrenchold and young (18+)

• 31:27 thumb_up 85%

  My pulverized Mouth Is Filled with Cum and Squirt. Am I a excellent hoe? Compilation

  7 months ago

  HDSexpissingsquirtbukkakecreampie compilationass to mouthcompilationgangbang

• 11:01 thumb_up 94%

  Watching Her Take It In The Ass

  3 years ago

  xHamsteramateurblowjobmature analanalMILFhookerswallow

• 29:21 thumb_up 75%

  Camera man! Please cum in me, OMG! pump loads of sperm deep inside my big juicy wet pussy, hurry up and fuck me hard, close ups

  10 months ago

  xHamsteramateurarabcreampiechubbywifeBBWcumshot

Categories

Other free porn sites