Mature • Cum In My Pussy 6,181 videos

• 10:07 thumb_up 79%

  Please dont Cum in my Pussy! Married Mature MILF with Big Ass Cheating in Bathroom

  2 years ago

  xHamstermatureamateurmomitaliancreampiemature analanal

• 22:12 thumb_up 81%

  Married Slut gets a Hard Fuck Deep in her Throat and a Huge Cumshot in her Fucking Mouth!

  1 year ago

  xHamsteramateurmomwifeMILFcheatingbig titscumshot

• 28:07 thumb_up 48%

  Please slow down, I dont want you to cum in my still fertile pussy, i might get pregnant, is that your sperm flooding my inside?

  1 year ago

  xHamstermatureamateurmomhomemadearabfatcreampie

• 11:31 thumb_up 82%

  I Cum In My Hairy Mom - Teen

  3 years ago

  xTitsmatureamateurmomhomemadeblowjobcreampiePOV

• 54:12 thumb_up 80%

  100% Reel anal: I transformed my little French granny into an anal slave..

  2 years ago

  xHamstermomhomemadefrenchmature analanalsquirtgranny

• 14:16 thumb_up 80%

  Having the Neighbor's Wife Over for a Gangbang

  6 years ago

  xHamstersmall cockswingerinterracialwifegangbangclose upcum in mouth

• 05:51 thumb_up 77%

  He fucks my mouth and cums on my face

  2 years ago

  xHamstermomfacialdirty talkcum in mouthpuffy nipplessaggy titscum on pussy

• 22:53 thumb_up 75%

  Hot wife gets satisfied by her neighbor

  2 years ago

  xHamsterkissinggermanwifeorgasmswallowbig clitcum in mouth

• 31:51 thumb_up 76%

  30 MINUTES OF BEST CUMSHOT !!! Part 4

  2 years ago

  xHamsterhandjobhomemadeblowjobwifebig titscompilationcumshot

• 05:29 thumb_up 74%

  Voyeur in the car on a rest area, I jerk him off with my breasts, empty his balls, he uses me like a whore and squirts in my mouth

  1 year ago

  xHamsterhomemadepublicfrenchvoyeurcreampiesquirtwife

• 02:24 thumb_up 83%

  At First I Was Embarrassed to Undress in Front of Camera, but Soon My Legs Were Spread Wide Open and Cum Dripping From My Pussy

  2 years ago

  xHamsterclose uphomemadecuckoldcreampiehousewifewife

• 05:43 thumb_up 83%

  Showing Her Hairy Pussy My StepSister Offered to Jerk Together. Handjob before bed. Cum in panties.

  4 years ago

  xHamsterhandjobhomemadefrenchhairyjerkingmasturbationpanties

• 07:45 thumb_up 59%

  You'd like to fuck me like a whore and squirt in my pussy Insult me and treat me like an empty balls slut humiliate me

  2 years ago

  xHamsterfeetfrenchsquirtwifeMILFhookerfisting

• 06:03 thumb_up 52%

  I really like to cum on my mother-in-law's sexy thighs

  2 years ago

  xHamstermaturepublicrussianchubbyoutdoorold and young (18+)mother in law

• 30:47 thumb_up 76%

  My husband watched me fuck other men in a swing club I got my asshole and my pussy all open, hard sex

  4 years ago

  xHamsterhomemadeswingeranalBDSMcuckoldorgycum in mouth

• 11:16 thumb_up 74%

  My wife ends up jerking off with my friend, cum on hairy pus

  4 years ago

  xHamsterhiddenhairylatinawatchingcum on pussyjerking

• 06:14 thumb_up 61%

  I let my acquaintance fuck my wife in pussy and he slightly pull out his cock at the end of fucky-fucky and almost cum in her -Milky Mari

  1 year ago

  MatureClubhomemadecreampiechubbycheatinghairyBBWbig tits

• 22:18 thumb_up 81%

  Wifesharing because his wife wants to feel a big cock

  2 years ago

  xHamstergermanhairydoggingwatching

• 1:07:19 thumb_up 78%

  Bang my wife! Extreme Sperm and Piss Bareback-Gangbang! Full Movie

  4 years ago

  xHamsterpissingcreampiegermansquirtwifespermswallow

• 27:52 thumb_up 70%

  Stepmommy's Boy is Back

  4 years ago

  xHamstermaturemomcreampiecum in mouthpussybig titscumshot

• 32:39 thumb_up 83%

  Melody Mynx My Friends Hot Mom - Mature Milf Massive Saggy Busty Tits Kitchen Housewife Clothed Ripped Busty Lingerie Femdom Hardcore Missionary Standing Spread Doggy Under Hairy Pussy Lips String Heels Cowgirl Feet Red Toes Great Fuck Till Cum Cum

  2 months ago

  TheyAreHugematurefeetfemdomcreampiemature analanalwife

• 13:23 thumb_up 67%

  Amazing Ffm Threesome I Fuck My Wife And Her Best Friend And Cum In Pussy

  1 year ago

  DesiPornTubewifeskinnycreampieFFM

• 20:18 thumb_up 89%

  I AM UNFAITHFUL TO MY BASTARD OF A HUSBAND WITH MY STEPSON

  10 months ago

  SunPornobeautyanalcouplenaturalpantiescougarcum in mouth

• 20:36 thumb_up 86%

  Costas gives his favorite mature neighbor a huge facial - German retro

  4 years ago

  xHamstergermangrannyhairyswallowvintagecum in mouthneighbor

• 15:55 thumb_up 63%

  Fucking My Wife in Honeymoon Night Cum in Pussy Creampie Dripping Wet Pussy

  2 years ago

  xHamsterindiancreampieasianwifehairyjapanesebig tits

• 22:22 thumb_up 89%

  My hot stepmother caught me wanking....

  4 years ago

  xHamstermaturemomMILFbritishstepmomcaughtswallow

• 05:14 thumb_up 57%

  French Husband Wants Guys To Fuck His Algerian Wife And Cum In Her Hairy Pussy

  1 year ago

  xHamsteramateurfrenchcreampieswingerwifehairycuckold

• 20:44 thumb_up 77%

  He fucks his own grandma in the ass!

  2 years ago

  xHamsterblowjobanalgrannywetold and young (18+)pussygranny anal

• 06:05 thumb_up 79%

  Stepson fucked his stepmother right in the kitchen

  3 years ago

  xHamsteramateurdoggingupskirtkitchensurprisecum on pussytight

• 02:57 thumb_up 70%

  Ooh yes fuck me harder in my ass & cum inside slam your cock in me deep oooh i am having a orgasm my cunt & my ass

  3 years ago

  xHamstergrannyorgasm compilationcompilationdirty talkgranny analwhoresaggy tits

• 03:38 thumb_up 85%

  After a long abstinence his premature ejaculation covered my pussy in hot cum.

  3 years ago

  xHamsteramateurcuteclose up

• 15:38 thumb_up 83%

  Fuck me in the bathroom and cum in my ass

  2 years ago

  xHamsteramateurmomkissingmature analanalchubbywife

• 38:44 thumb_up 69%

  Our ebony maid caught me jerking off and helped me to relief

  4 years ago

  xHamsterebonyamateurfrenchanalmaidass to mouthcaught

• 08:33 thumb_up 88%

  My ex-girlfriend gave me her pussy to get a good portion of creampie.

  1 year ago

  xHamstermissionaryhairycreampieclose upgirlfriendtight

• 05:04 thumb_up 74%

  I came to visit my mother-in-law and fucked her and finished twice close up

  2 years ago

  xHamstermaturecreampiemother in lawrussiandogging

• 07:59 thumb_up 86%

  I Love To Stretch My Pussy With My Hands, Let The Pussy Gape

  5 months ago

  uAnalcreampiesolomasturbationrussian

• 07:59 thumb_up 78%

  Perverted stepbrother licks my gangbang sperm cunt and squirts deep inside

  4 years ago

  xHamstergermanspermgangbangcum in mouthcreampie

• 26:04 thumb_up 69%

  He loves the salty taste of hairy grandma pussies - East German 80's retro

  4 years ago

  xHamsterhomemadegrannyMILFBBW

• 05:34 thumb_up 85%

  First I was allowed to come, then he satisfied himself in me

  2 years ago

  xHamsteramateurhomemademasturbationhairywifecum on pussy

• 18:22 thumb_up 77%

  I help my stepsister clean the dining room and we end up fucking on top of him

  3 years ago

  xHamsterindianlesbianbisexualdildoass lickingmasturbationpussy

• 09:20 thumb_up 87%

  Don't cum inside blindfolded stepmom! Oops step son creampied in stepmom's pussy - Kisscat

  3 years ago

  xHamsteraccidentmissionarysurpriserussiansmall titspregnant

• 32:13 thumb_up 69%

  Retirement home caretaker loves threesomes with the grannies

  4 years ago

  xHamstermaturegermangrannyswallowvintagecum in mouthpussy

• 13:22 thumb_up 80%

  She Wants That Black Seed

  4 years ago

  xHamsterspermmature analinterracial

• 14:24 thumb_up 87%

  Cuck Films Wife

  5 years ago

  xHamsterhomemadewifecuckoldswallowcum in mouthstranger

• 1:19:31 thumb_up 65%

  Hot couple fucks horny granny

  2 years ago

  xHamsterkissinggermannaturalbig clitpussygranny

• 16:10 thumb_up 60%

  AMATEUR GRANNY PORN: 80 YEARS OLD GRANNY GAGGING AND SWALLOWING AFTER ANAL SEX 3of3

  3 years ago

  xHamsterhairyass lickinggrannyfeet

• 28:05 thumb_up 89%

  Mom Wants My Cum In Her Panties

  1 year ago

  TheyAreHugedoggingmissionarymombig titspantiesriding

• 29:46 thumb_up 57%

  My Pussy Gonna Pound Your Cock so Hard, It's Gonna Drive You Nuts, Oh My God, I Am Cumming Deep Inside! M

  1 year ago

  xHamsterfatcreampiemature analgrannyBBCgranny analinterracial

• 05:24 thumb_up 78%

  REAL SEX WITH MY STEPMOM I ENDED UP CUMMING IN HER PUSSY

  3 years ago

  xHamstergrannyBBWcreampie compilationclitstepmomcompilationbig clit

• 08:07 thumb_up 77%

  Couples vacation: my friend's girlfriend in the bathroom gives me a nice with cumshot in her mouth

  2 years ago

  xHamsteritalianhiddenvacationhandjoblesbianbathroom

• 33:02 thumb_up 75%

  If you want to bake a cake, you need protein

  4 years ago

  xHamsterfrenchanalMILFass to mouthcum in mouthkitchen

• 13:26 thumb_up 70%

  Stepson's friends jerk off looking and touching my hairy pussy and cum in front of me

  2 years ago

  xHamsterhomemadenyloncuckoldmaturevoyeurerotic

• 28:03 thumb_up 81%

  My mother in law loves to get her hairy pussy doggy trimmed - retro

  4 years ago

  xHamsterhairyass to mouthglassesmother in lawgrannyvintage

• 07:11 thumb_up 79%

  The penis is all in my pussy juice and I suck it and lick it clean.He fucks me and cums inside me.

  2 years ago

  xHamsterdirty talksaggy titshairycreampie

• 13:08 thumb_up 83%

  Please pee on my cock. Now I will fuck you and urinate inside. Wife gets an orgasm while I pee in her cunt. Close up.

  3 years ago

  xHamsterpissingsquirtclose uppussycum on pussygerman

• 07:59 thumb_up 82%

  I want your CUM on my HAIRY PUSSY! I will masturbate in front of you and make you a handjob EVA MYST

  1 year ago

  xHamsterhandjobstockingsjerkingmasturbationclose upcum on pussy

• 16:44 thumb_up 80%

  Fuck and cum inside mouth creampie pussy whore stepmom big boob share in pov this slut milf multiple cum on stepmother b

  3 years ago

  xHamsterwifetiedcum in mouthcum on pussywhoredeepthroat

• 18:17 thumb_up 56%

  I knew I should not have drank the free drink sample from the stranger, it was loaded with his sperm, OMG!!!

  3 years ago

  xHamsterpissingstrangerBBWjerkingspermJOI

• 18:22 thumb_up 53%

  My husband's cuckold wanted to be angry, I put him in his place, after having sex with a friend

  2 years ago

  xHamstercarhomemadedirty talkcreampielingerieMILFbrazil

• 07:59 thumb_up 84%

  Amy Lustful Libertines, Lustful Libertines And Stephen Lustful Libertines In Fucking My Neighbours Cheating Milf Wife

  7 months ago

  KePornnaturalhairycheatinghomemadeamateurbig tits

• 19:40 thumb_up 75%

  Littel nasty teenie girl wants my big knob in her wet hoochie-coochie

  7 years ago

  XoZillahomemadeteen (18+)creampiemature analteen anal (18+)big titsspy

• 07:10 thumb_up 79%

  My man drinks my golden nectar and indulges in creampie under female dominance

  1 year ago

  XXXVoguebathroomcuckoldfemdomfacesittinghomemadetoilet

• 20:53 thumb_up 74%

  Mature Women in heat fucking! Fifty-Year-Old Women Wanting for the Pouring Sperm -4

  1 year ago

  xHamsterhandjobMILFcheatingjapanesespermjapanese momjapanese wife

• 10:03 thumb_up 80%

  Please don't cum inside, My husband in next room! Cheating Wife Creampied After Party

  1 year ago

  xHamsteramateurcreampiehusbandclose up

• 23:32 thumb_up 79%

  Wow, is that a thick and huge cock! Fan blow up my holes! creampied me my cunt and cumshot me in my mouth! Full Movie

  3 years ago

  xHamstercreampiemonsterpiercingswallowcumshotfull moviecum in mouth

• 09:02 thumb_up 69%

  Dogging - we nail my wifey in front of the public and i pack her with cum

  5 years ago

  HogTVpublicpussy

• 12:58 thumb_up 74%

  Everybody Gets to Fuck Our Neighborhood Teens

  5 years ago

  xHamsterbisexualdoggingcum in mouthslutfingering

• 22:49 thumb_up 83%

  Fuck My Big Hairy Pussy

  3 years ago

  xHamstercreampiehairyBBCpussyinterracial

• 25:02 thumb_up 80%

  I fuck my boss's delicious ass for the first time

  2 years ago

  xHamsterBBCbossgranny analgrannymature analass licking

• 33:14 thumb_up 82%

  MATURE MOM Gets Even With Son by Fucking his Best Friend!

  2 years ago

  xHamstermatureMILFbig titscum in mouthmomswallow

• 34:08 thumb_up 71%

  Pretty French secretary takes an anal break

  4 years ago

  xHamstermomfrenchanalofficesecretaryMILF

• 06:11 thumb_up 70%

  I make you a statement I want to fuck and reach my broom friend

  2 years ago

  xHamsterhiddenmature anal

• 12:52 thumb_up 89%

  My Wife Begged for Creampie after BBC gave her Leg Shaking Orgasms

  1 year ago

  SunPornocreampieinterracialwifeorgasmbig cockassBBC

• 01:07 thumb_up 70%

  CUCK HUBBY PRECUMS ALL OVER BBW MILF SLUTWIFES PUSSY & THEN EATS IT FROM HER HAIRY PUSSY

  3 years ago

  xHamsterbritishdirty talkslut

• 05:16 thumb_up 64%

  PUSSYTALK! Cum in my PUSSY!

  2 years ago

  xHamsterdirty talkJOIinstruction

• 21:51 thumb_up 80%

  Fucked my best friend's MILF mom and cum in her pussy

  1 year ago

  xHamsteramateurmomhomemadecreampiePOVpartyrussian

• 15:18 thumb_up 82%

  STEPMOM LICK HER STEPSONS ASSHOLE AND GETS FUCKED ANAL

  4 years ago

  xHamstermatureamateurmature analass lickingcum in mouthpussy

• 06:40 thumb_up 63%

  My Pussy Gonna Cum, Hurry up and Bust Your Nut Now! Horny as Fuck, Huge BBW Shower

  1 year ago

  xHamsterfatgrannyorgasmBBWcaughtshowerjerking

• 19:30 thumb_up 64%

  Oh My God, Are You Really Cumming? I Told You No Penetration, Only grope My labia with Your knob, Dont You Dare Cum in Me

  5 months ago

  MatureClubhandjobhomemadegropedchubbyBBWass to mouthnatural

• 15:56 thumb_up 68%

  My husband came from a business trip fucked me and let all the cum into my mouth

  2 years ago

  xHamsteramateurhomemadewifekoreancum in mouth

• 05:15 thumb_up 25%

  My Whores Mouth Offered to 2 Subscribers to Serve as Empty Balls Photo Slideshow

  2 months ago

  $$ FapHousematurefrenchcum in mouthamateurthreesome

• 29:42 thumb_up 86%

  Love making Time With My Arousing Girlfriend

  1 month ago

  XoZillahandjobhomemadeteen (18+)lesbiananalteen anal (18+)double anal

• 01:21 thumb_up 57%

  2 Young People of 19 and 23 Years Old Fucked Me Like a Whore, One in My Ass the Other in My Pussy Until I Filled with Cum

  10 months ago

  $$ FapHousefrenchold and young (18+)whoresolo

• 06:09 thumb_up 77%

  Stepmom milf saggy tits riding my big cock till i cum in her pussy fetish taboo

  3 years ago

  xHamstermomfemdomteen (18+)creampieanalteen anal (18+)lingerie

• 33:59 thumb_up 71%

  She was desperate for sex and she squirted as soon as I put my fingers in her pussy

  4 years ago

  xHamstermatureblowjobPOVmature analanalsquirtorgasm

• 05:44 thumb_up 64%

  Husband tied me up and let real stranger from Reddit cum in my pussy- TWICE!

  1 year ago

  xHamsterwifehomemadedouble penetrationtied

• 39:25 thumb_up 78%

  As a creampie and mud fuck bitch at the next bachelor party!

  2 years ago

  xHamstercreampiespermswallowcumshotgangbangslut

• 19:17 thumb_up 77%

  Husband enjoys watching his busty Indian wife banged by 2 cocks

  4 years ago

  xHamsterindiananalswallowthreesomecum in mouth

• 09:14 thumb_up 79%

  MILF, fuck me hard but romantic and cum in my pussy. Homemade video of amateur wife

  2 years ago

  xHamsteramateurcreampieBBWpussywife

• 07:55 thumb_up 88%

  My personal Life : lollipop Ninja crams Me UP - Goddess Brianna Beach

  5 months ago

  HDSexkissingblowjobbeachcoupleorgasmass to mouthass licking

• 11:28 thumb_up 47%

  My stepbrother astonished me while I was resting.

  7 months ago

  HDSexhousewifegermanauntdirty talkamateurindian

• 17:06 thumb_up 80%

  Pussy licking. Cunnilingus. Husbands friend licked pussy wife, fucked in classic pose, cum in pussy. Creampie. Cumshot

  3 years ago

  xHamsterstockingscreampiewifehusbandclassicspermupskirt

• 07:06 thumb_up 66%

  Strangers Cum In My Swimsuit Panties On Public Beach! Risky Big Tits Red Hairy Pussy Milf With Ginger Ale

  3 years ago

  HClipsbeach18swimsuitoutdoor

• 06:41 thumb_up 87%

  My Stepmother Thinks That It Is Her Husband Who Touches Her. Part 2. I Fuck Her Until I Cum In Her Pussy

  3 years ago

  ManySexmatureBDSMbondageBBW

• 07:50 thumb_up 85%

  Pissing in my ass for the first time

  4 years ago

  xHamsterpissing

• 11:17 thumb_up 76%

  Fuck me and cum in my pussy!

  2 years ago

  VipTubebig cockPOVcreampie

• 31:38 thumb_up 83%

  JC picks up a hot granny for a deep and hard pussy pounding

  4 years ago

  xHamstergrannyafricanBBCpick upcum in mouth

• 20:08 thumb_up 82%

  Big young cock cums way too early in sex with experienced step mom

  2 years ago

  xHamstermomquickiecheatingsperm

• 16:24 thumb_up 75%

  Jerking Off Together with Stepson Watching Porn Until He Cums in My Bushy Pussy

  3 months ago

  JizzBunkeramateurvoyeurcuckoldjerkingbig cockwatchingpussy

• 07:05 thumb_up 82%

  My husband's friend saw me fucking my pussy and cum in me

  3 years ago

  xHamsterrussianwhore

• 09:23 thumb_up 80%

  I fuck standing my neighbor in very sexy white lingerie. and i fill her pierced pussy with cum

  4 years ago

  xHamsterneighbormomlingerie

• 13:18 thumb_up 79%

  My wife likes when I cum in her hairy pussy

  5 years ago

  BravoTubehomemadehairycouple

• 10:51 thumb_up 75%

  Lick My Mature Pussy in Tiny Panties and Ill Cum in Your Mouth. Big Cunt Close-up

  3 months ago

  JizzBunkermatureamateurhairyBBWclose uppussy

• 09:03 thumb_up 74%

  Step mom sucks and JERKING OFF at the car wash in public

  4 years ago

  xHamstercarjerkingJOI

• 36:29 thumb_up 70%

  FetSwing Diaries Season 5 Episode 8 The Loft Atlanta Club Take Over Party March 2022 - Naughtya J Moon -Belle A Roxxxa

  4 years ago

  xHamsterswingerpartycum in mouthclubcoupleskinny

• 07:51 thumb_up 66%

  Wank into my mouth

  3 years ago

  xHamstercoupledirty talkswallowcum in mouth

• 07:55 thumb_up 55%

  I Fuck My Old Granny Pensioner With Saggy Blue Tits And Cum In Her Pussy

  3 years ago

  TXXXmaturegrannyBBWsaggy titsgranny analrussian

• 07:45 thumb_up 53%

  Come and swallow my piss! l DADDYS

  2 years ago

  xHamsterpissingsmokingsquirtBDSMswallowcum in mouth

• 18:34 thumb_up 79%

  My husband's best friend gives me a big cumshot on my hairy pussy after we masturbate

  3 years ago

  xHamsteramateurmomsmall cockwifehairycuckoldhusband

• 27:50 thumb_up 81%

  Busty blonde milf Starla gets her tight pussy stretched by a BBC for the first time

  4 years ago

  xHamsterchubbyass lickingBBCinterracial

• 09:18 thumb_up 72%

  I Love Riding And Feeling A Man Cum Deep In My Fertile Pussy

  1 year ago

  HClipsridingbig tits

• 04:42 thumb_up 62%

  Desi Angel - I seduce my husband's best friend and he follows him with a hidden camera

  4 years ago

  xHamsterhiddenhairycum in mouthseduced

• 14:50 thumb_up 82%

  Amazing belly bulge and creampie

  3 years ago

  xHamsterfistinglactatingmilknipples

• 01:46 thumb_up 74%

  Angela Doll - Too horny guy cums in my pussy while he fucks me in underground parking lot

  4 years ago

  xHamsterpublicpartycar

• 05:37 thumb_up 80%

  Private sextape in the bathroom

  3 years ago

  xHamsterbathroom

• 08:01 thumb_up 85%

  Fucking my neighbours wife standing missionary and cumming in her pussy

  3 years ago

  xHamsterhiddenupskirtmissionary

• 11:01 thumb_up 93%

  Watching Her Take It In The Ass

  4 years ago

  xHamsteramateurblowjobmature analanalhooker18swallow

• 16:57 thumb_up 95%

  Granny in love! He kisses and licks the old lady for love

  4 years ago

  xHamstergrannynaturalhungarian

• 09:58 thumb_up 72%

  Woman caught stranger sniffing dirty panty in doctors office waiting room, that he took from his pocket

  3 years ago

  xHamsterpantiesBBWofficebig tits

• 19:38 thumb_up 71%

  The old spunker still knows how to ride a stiff cock

  4 years ago

  xHamsterGILFgranny

Categories

Other free porn sites