Mature • Bbw Creampie 19,650 videos

• 33:09 thumb_up 67%

  OMG! I am cumming again! your tongue is too deep inwards my fat fat pussy, it’s driving me nuts, hot old grandma sharing bed, pov

  7 months ago

  HDSexblackfatcreampiebig asschubbyorgasmass licking

• 01:22 thumb_up 60%

  Hotel Creampie With A Stranger Pt2 - TacAmateurs

  5 years ago

  HClipsshowerhotelstrangercouple

• 12:35 thumb_up 80%

  Ugly 79 years old mom first creampie

  5 years ago

  xHamstergrannyuglyredheadhungariancreampieBBW

• 01:06 thumb_up 92%

  Hot wife squat at your face with creampied pussy-Milky Mari

  4 years ago

  xHamstercuckoldhusbandbareback

• 25:19 thumb_up 85%

  Making my mature bbw neighbor soak her gnome panties

  5 years ago

  xHamstercreampiesmokingorgasmbig cockpantiesBBCPAWG

• 06:43 thumb_up 60%

  VISITING MY COUSIN I MAKE HER SQUIRT ALL OVER THE HOUSE

  3 years ago

  xHamstercameltoecousinneighborpick upcreampie

• 18:04 thumb_up 66%

  Hentai 3D Uncensored Compilation

  3 years ago

  xHamsteranimefutanari

• 10:57 thumb_up 90%

  Pussy Cum Cumming Missionary, Cuddles Afterwards

  3 years ago

  TheyAreHugeBBWcreampiewife

• 16:34 thumb_up 91%

  Jenn Cameron - Fucking Guys Half Her Age - Jenn cameron

  1 year ago

  xTitscreampieBBWMILF

• 16:25 thumb_up 71%

  Big ass sex with stunning Sarah Jessie and Marley Moore from Raw White Meat

  1 year ago

  OkXXXBBWanalinterracialcreampiedoggingcreampie compilation

• 21:47 thumb_up 78%

  Family pal Shares Wifes labia With hubby In MMF Spit Roast (1 of 2)

  7 years ago

  HDSexMMFcreampiechubbyBBW

• 1:31:28 thumb_up 86%

  Horny Wife Bang Strangers & Records for Husband to watch

  5 years ago

  AnaldincreampiethreesomewifeBBWhusband18watching

• 51:39 thumb_up 67%

  Super hot surfer asian lady hardcore

  5 years ago

  Analdinpublicasianfootjoblatinadouble anal18japanese massage

• 03:43

  Curly_Dreams First strip then fuck

  3 years ago

  xHamstergermansaggy titscreampie

• 1:58:10 thumb_up 62%

  Mother-in-law secretly satisfies her son-in-laws sexual desires

  4 years ago

  JizzBunkercreampiejapanesejapanese mommother in law

• 29:13 thumb_up 85%

  SUZEE QUE BBW 1ST EVER GANGBANG

  2 years ago

  xHamsterblackgrannyBBWGILFdeepthroatcreampie

• 12:43 thumb_up 86%

  Fucking My Wifes MILF Friend and Filling Her Big Hairy Pussy with Cum

  7 months ago

  $$ FapHousecreampiewifechubbyhairycheatingBBW

• 10:32 thumb_up 76%

  Hot Bbw Roommate Demands Sex In Exchange For Rent 11 Min - Paige Steele, Steve Steele And Steve Rickz

  1 year ago

  HClipscreampiehairycumshotBBW

• 10:25

  Big Fat Ass White Woman Riding Black Man Cock Hard, He Starts Moaning and Shooting Cum Deep in Her Pussy - BBW

  2 weeks ago

  XXXDanbig cockdirty talkamateurebonyinterracial

• 30:53 thumb_up 50%

  Just pound Me rock-hard and prompt Deep Inside My Juicy Pussy, Best Sex Ever, Fill Me up with Cum, BBW Riding

  2 months ago

  MatureClubridingBBWmaturegrannychubbyamateur

• 18:27 thumb_up 82%

  Creampied at an Interview

  6 years ago

  HDZogcastingcreampiedoggingauditionBBW

• 33:16 thumb_up 82%

  Her Japanese hairy snatch gets penetrated and creampied after a shower

  3 years ago

  xHamsterauditionbig clitjapanese uncensoredjapanese massage

• 03:37 thumb_up 71%

  Stranger impregnates my wife with a huge creampie! - Milky Mari

  4 years ago

  xHamsterstranger

• 26:03 thumb_up 80%

  Pretty babe loves creampie

  2 years ago

  XXXDanfisting

• 10:23 thumb_up 89%

  Rosy puss - anal creampie action - Mature NL

  3 years ago

  PornHatfatbig assinterracialpiercingnaturalfirst time

• 08:00 thumb_up 50%

  Doa-090 Busty Wife Tied Up And Flowers

  1 year ago

  ManySexasianwifebondagetied

• 08:12 thumb_up 64%

  Couple Fucks the Sex Therapist

  1 year ago

  xHamstermaturecreampiedouble penetrationcoupleBBW

• 05:21 thumb_up 78%

  Bent Over Taking Another Quick Hair Pulling Breeding During Our Anniversary Vacation

  1 year ago

  xHamsterredheadmomhomemadecreampienaturalvacation

• 22:10

  Desi Two Mallu Bhabhi Hardcore Fuck with Her Debar When They Are Alone at Home Full Movie ( Hindi Audio )

  4 weeks ago

  $$ FapHousematurethreesomeBBWfull moviepussyhardcore

• 12:10 thumb_up 81%

  The Goat of Birmingham Alabama trains another mans wifey to be a great slut

  9 months ago

  MatureClubebonyBBWblackBBCass to mouth

• 17:55 thumb_up 68%

  German chubby girls anal and ass to mouth threesome ffm

  2 years ago

  xHamsteranaldoctorBBWFFMchubby

• 15:30

  My stepfather is no longer convincing him, StepMama woke up for me at night, he was full of me, Wow, I don't care, Shalia H

  1 year ago

  xHamsterhomemademature analanalcreampie

• 05:11

  Slow motion footage of my stepson fucking me and filling my pussy several times in a row with hot sperm

  2 years ago

  xHamsterpanties

• 29:23 thumb_up 86%

  Stoneage threesome.

  1 year ago

  xHamsterswingeranalthreesometeachergranny anal

• 26:06 thumb_up 80%

  Vika Borja chubby spic mommy porn video

  1 year ago

  Analdincreampiemomstory

• 21:13 thumb_up 84%

  Well-formed goddess - landlady clip - Aunt Judys XXX

  3 years ago

  PornHatBBWglassesauntbritish

• 1:03:38 thumb_up 77%

  Femmes Fontaines Et Amatrices - Hpg Prod Dvd

  3 years ago

  Uporniastockingsanalbig cock

• 08:00 thumb_up 71%

  Amateur chubby wife is fucked by skinny husband in the bathroom

  3 years ago

  MyLustcreampiechubbywifeBBWbathroom

• 03:04 thumb_up 64%

  In a beach chair and an old garage I fuck two bitches ass

  2 years ago

  xHamstergranny anal

• 21:20 thumb_up 71%

  Stepmom and Stepson share a bed in a hotel room. Whose mistake is this?

  2 years ago

  inXXXstepmomhotelredheadcreampie

• 05:24

  Femdom Big Boobed Milf Ride My Cock In Reverse Cowgirl And Cowgirl Pose And Get Creampie - Milky Mari

  4 months ago

  PePornBDSMfatBBWridingfemdom

• 50:16 thumb_up 85%

  Dirty Director 02

  4 years ago

  Uporniamature anal

• 07:54

  Anal, Double Penetration, Creampie, Deep Throat And Cheating With Big Black Cocks

  1 month ago

  UporniaBBWstockingsdouble penetrationinterracialBBC

• 30:51

  Hotels Fitness Coach, Hard Fucks The Bitch In The Classroom, In All Positions And Cums On Her - Lana Rhoades

  3 years ago

  TheyAreHugesport

• 1:59:04 thumb_up 76%

  Wife invites a sex friend over to her house and has sex while her husband is away

  4 years ago

  XXXDanjapanese wife

• 02:56 thumb_up 67%

  Guys Run A Train On Married Milf

  2 years ago

  xHamsterfacesitting

• 24:20 thumb_up 81%

  Homemade Interracial Porn with Chubby PAWG - creampie

  1 year ago

  DrTuberchubbyBBWamateurcreampieinterracial

• 07:13 thumb_up 67%

  When I come to my milf, she always shows what's under her robe and jumps on my dick.

  1 year ago

  xHamsteramateurBBWcreampiehomemade

• 26:39 thumb_up 82%

  Ebony Beautys Massive Curves in a Wild BBW Passion Tale

  4 months ago

  xHandlesbianbig cockteen (18+)creampieamateur

• 11:22

  Oops I Creampied in My Stepmom Vol 3

  5 months ago

  HDSexteen (18+)orgasmhairystepmomtitjobaccident

• 18:00

  Naughty Stepmom Fucks Hot Anal in Front of Stepson Teasing Him

  1 month ago

  $$ FapHouselatinacuckoldstepmomBBW

• 11:42 thumb_up 80%

  Chubby amateur milf hooker meet a user and get creampie

  4 years ago

  xHamsterhookerprostitute

• 06:37 thumb_up 80%

  Danish MILF cunt boned

  7 years ago

  TXXXcreampiehairyBBWclitdanishbig clitfingering

• 02:19 thumb_up 69%

  Hotwife bbw show pussy creampie

  3 years ago

  xHamsterhomemadejapanese uncensoredjapanese wifeamateur

• 08:00 thumb_up 86%

  Bbw Slut Begs For Cock & Creampie

  3 years ago

  HClipscoupleBBW

• 38:59 thumb_up 76%

  Horny grandma enjoys stroking his large ebony shaft

  1 year ago

  XXXVoguefull moviegrannychubby

• 07:55 thumb_up 67%

  Big Round Ass Stepmommy Nympho Enjoys Ass Pumping Double Penetration With Colleagues - Jason Carrera, Cris Angelo And Montse Swinger

  6 months ago

  uAnaldouble anal

• 26:53 thumb_up 50%

  Curvy wife experiences intense anal pounding

  1 year ago

  XXXVoguewife swapswingercuckoldhomemade

• 11:12

  Redhead SSBBW Julie Gingers Wild Double Feature: Bts Threesome Massive Gangbang with Multiple Cocks!

  1 month ago

  JizzBunkerBBWslut

• 30:16 thumb_up 82%

  Carmella Bing In The Kitchen HD-carmella bing follada en la cocina: Big Tits, Big Ass Blowjob Porn

  5 months ago

  XXXDanmaturekitchencreampie

• 12:47 thumb_up 65%

  German Fat Chubby Housewife Make Bareback Gangbang Party

  3 years ago

  HClipsstockingsfatgangbanggermanbareback

• 14:10

  Cuckold Humiliation - Getting Fucked and Filled with His CUM. Are you gonna eat it?

  2 years ago

  xHamsterfemdomsmokingcuckoldbukkake

• 47:28 thumb_up 80%

  Melani3 Big Booty African 6

  2 years ago

  Uporniaebonybig cockafrican

• 06:14 thumb_up 73%

  Cum Comp 05-29-21, Scene #01

  1 year ago

  PornLmatureswallowgloryholeBBWblowjob

• 07:57 thumb_up 50%

  Doing an anal too hard made her do an anal prolapse

  2 years ago

  xHamsterblackgrannylactatingswallowgranny anal

• 26:13 thumb_up 80%

  Shy Young Wife Joins Couple For The First Time In Interracial Threesome

  5 years ago

  TXXXcreampiethreesomecouplewifeshyfirst time

• 16:29 thumb_up 79%

  Im showing Donald Cook on his wedding anniversary that Agnes will NEVER be his again... Brett

  4 years ago

  XXXDanbridegrannyorgasmcuckoldwedding

• 43:17 thumb_up 56%

  48 Year Old Japanese Mother

  4 years ago

  Uporniaasianjapaneseanalcreampie

• 09:22 thumb_up 80%

  How To Use A Female Condom

  3 years ago

  HClipscondomBBW

• 23:26 thumb_up 80%

  Jawan Pote ko Bade Bade Dudhwali Dadiji ne achhe se Chodna Sikhaya condom ke sath ( Hindi Audio )

  3 years ago

  xHamsterindianMILFfacesittingold and young (18+)condompakistani

• 16:12

  Mature BBW cowgirl rides with floppy tits gets internal creampie

  1 year ago

  XXXVoguesmall cock

• 07:57 thumb_up 88%

  Thick milf gets creampied each time he fucks her compilation

  8 months ago

  AnySexamateurcreampie compilationcreampieBBWcompilation

• 09:56

  Hardcore action and facial for German goth BBW Abby Strange in a hot MMF threesome

  1 year ago

  XXXVoguebarebackmomBBW

• 03:30 thumb_up 88%

  Lookinforfun3334 PAWG cum slut rides a huge white cock!!!

  5 years ago

  xHamsterridingslutPAWG

• 08:00 thumb_up 86%

  Bbw Fuck Trailer With Delightful Shooting Star From Judys Xxx

  4 months ago

  xMILFblondeBBWmaturecreampieaunt

• 17:59 thumb_up 48%

  Eve Laina - ANAL Compilation, BIG ASS MILFs, Cum in Ass.

  3 years ago

  xHamsterturkishcreampie compilationcumshot compilationPAWG

• 22:53 thumb_up 81%

  AuntJudysXXX - Busty BBW Landlady Camilla Creampie lets her Broke Tenant pay the rent in Cum

  2 years ago

  xHamstermaturebig titsbritish

• 05:30

  BBW Amateur Wife Masturbating In Pantyhose & Cumming, While Talking Dirty (Loud Orgasm)(Mature Mom Fucking Vibrator) Nut

  3 years ago

  xHamsterpantyhoseplumber

• 05:21 thumb_up 50%

  Bareback breeding sex with a big boobed horny wife! Cum inside her pussy big creampie - Milky Mari

  2 years ago

  xHamstercreampie

• 06:17

  Prostate Massage From Slutty Bbw Doctor 19 Min

  2 years ago

  xMILFprostate

• 08:00

  A Cute Student 18+ Was Fucked, Cum On Her Face

  3 months ago

  ooXXXteen (18+)creampieamateurteen anal (18+)18

• 04:47 thumb_up 73%

  Wife Get Creampie Ate Out Of Her Then Fucked By Another Guy

  4 years ago

  xHamsterbig clit

• 28:56

  Busting In My Stepmom After School - Kaden Kole

  2 weeks ago

  TheyAreHugeteen (18+)creampie18stepmomPOVBBW

• 10:06 thumb_up 87%

  Cameltoe creampie! FULL vid. Mature hairy BBW cums on his face and takes big load. NZs BEST homemade content.

  3 years ago

  xHamsterhomemadecreampiewifecameltoehairypantyhose

• 19:35 thumb_up 72%

  Pussy Full Of Sperm - German Creampie Bukkake Gangbang

  3 years ago

  HDZogswingerbukkakespermgangbanggroup

• 27:21 thumb_up 71%

  Gang bang banging in chubby pussy hole

  1 year ago

  xHamstergangbangamateurold and young (18+)swingercreampiewife

• 40:54

  Yasminas First Gangbang Including Double Penetration With Yasmina Khan

  5 months ago

  DesiPornTubegroupgangbangdouble penetrationindian

• 48:22 thumb_up 79%

  Married woman cheating japanese massage

  1 year ago

  XXXDanBBWcheatingjapanese massagemassage

• 08:00 thumb_up 63%

  Flexible Mistress Face-sitting Session

  4 months ago

  uAnalmature analmaturefemdomfacesittingflexible

• 08:00 thumb_up 73%

  Camming Couple

  5 months ago

  ooXXXcouplehairycreampiesquirtBBWtoys

• 24:29 thumb_up 79%

  Cougars Porn Shyla Shy, Big Busty

  5 years ago

  TheyAreHugeshycreampie

• 15:30 thumb_up 63%

  The old man and the girl next door - Hentai 3D V115

  2 years ago

  xHamstercuckold

• 17:59 thumb_up 62%

  Mom Sunburn Oh Dear, Big Ass Sucharita Teaches Her Best Friend How To Fuck With A Girl – Full Movie

  3 years ago

  TheyAreHugefull moviemom

• 05:06

  Cuckold husband do a messy sloppy seconds sex with his cheating wife - Milky Mari

  1 year ago

  xHamsterwifehomemade

• 25:55 thumb_up 79%

  Mother-in-law and son-in-law

  2 years ago

  XXXDancreampiewifestepmombig cockcelebritymother in law

• 14:38 thumb_up 86%

  Fruity BBW smutty adult scene

  1 year ago

  AnaldinBBWmaturecreampiechubbybig tits

• 10:49 thumb_up 58%

  ONLYPERVS - AMATEUR GRANNY PORN: 80 YEARS OLD GRANDMA ANAL SEX CREAMPIE 4of5

  1 year ago

  xHamsterhomemadecreampiemature analgrannyBBWold and young (18+)granny anal

• 42:32 thumb_up 79%

  Mature Lady With Huge Natural Tits Gets Anal Pounded By a Big Black Cock

  1 year ago

  xHamsterblackfatinterracialBBWbig titspiercingnipples

• 09:52

  Super-hot stepmom Chubbybigbooty gets naughty and asks for a creampie in her hairy pussy

  3 months ago

  XXXVoguemomhomemadespanishBBWchubbyclose up

• 05:23 thumb_up 82%

  My hotwife husband cant stop cumming while he sees my creampie - milky Mari

  5 months ago

  XXXVogueamateurcreampiehairyhomemadecuckoldBBW

• 31:45 thumb_up 82%

  Creampie Gang-fornicate For Older Mommy

  6 years ago

  XoZillagangbangbareback

• 19:23 thumb_up 70%

  Gym Teacher Gets Creampie From Her Student 20 Min

  3 years ago

  HDZogcreampieold and young (18+)teacher

• 08:35 thumb_up 75%

  Slutty wife willingly remove condom from my best friends cock and ask him to creampie her fertile pussy! - Milky Mari

  3 years ago

  xHamstercreampiehairyBBWcuckoldcondomwife

• 25:08 thumb_up 67%

  Busty BBW Kamille Amore - Milk and Chocolate Before Bed - Interracial rough sex and deepthroat blowjob

  1 year ago

  xTitsgaggingfacialswallowdeepthroathardcorePAWGbrunette

• 07:45 thumb_up 60%

  Granny Pixie: He Made My Pussy Drip Cum. 01152023 CAMS126

  2 years ago

  xHamsteramateurwifecreampiegrannylingeriemissionary

• 08:00 thumb_up 60%

  Bosnian Beautyy - So Clean Shes Dirty ( ) 1080p

  4 months ago

  xMILFPOVBBWcreampie

• 08:14 thumb_up 50%

  Linen and Lace Besties in big black cock internal ejaculation Cleanup

  3 months ago

  HDSexthreesomelingeriefacesittingass to mouthnaturalFFMwhore

• 25:47 thumb_up 83%

  Savor Megans mesmerizing ebony curves in passionate intimacy

  3 months ago

  AnaldinPOVebonyteen (18+)

• 11:17

  A fortunate turn for a 57-year-old female, as the sequence 6892 3 2 unfolded.

  3 weeks ago

  TXXXmatureblowjobBBWfrenchanalcreampie

• 11:06 thumb_up 60%

  More 100 Cum Shots

  1 month ago

  TXXXcumshot compilationebonycreampie compilationanalcompilationBBW

• 07:28 thumb_up 40%

  I am a calm sweet wife with my husband, but a kinky breeding slut with my lover. - Milky Mari

  2 years ago

  xHamsterBBWmissionarycuckold

• 15:05 thumb_up 61%

  Fleshy 3 way, jelly Spills in Both of Their Holes

  1 year ago

  VideoSectionamateurmature analwifedouble analasswife swapdouble penetration

• 11:24 thumb_up 78%

  Ouset's huge ass gets stuffed with cum

  1 year ago

  xHamsterlatinamature analhomemade

• 20:47 thumb_up 83%

  Gorgeous cougar Melody Minx mind-blowing sex scene

  4 months ago

  AnaldincreampieBBWbig titsbig asspussybrunette

• 05:33 thumb_up 75%

  Pregnant cheating wife Milky Maris loose pussy gets played with by cuckold spouse after gangbang

  1 year ago

  XXXVoguepregnantbig clitcuckold

• 15:27 thumb_up 83%

  Large-Breasted 18-Years-Old Pawg fucks Her Boyfriend

  6 years ago

  XoZillafatvoyeurchubbyBBWfacial18jeans

• 13:48 thumb_up 82%

  Ugly girl with big tits fucked

  4 years ago

  XXXDancreampieBBWuglypantiesMILFbig cock

• 13:08 thumb_up 73%

  Sbbws cougar gets butt sex - hot porn video

  4 years ago

  Analdinmomblondecougarhardcoreanalcreampie

• 11:37 thumb_up 43%

  Blonde teen with big natural tits fucked by stranger for money pov anal big ass

  2 years ago

  XXXDanteen anal (18+)

• 09:11 thumb_up 20%

  I Left My Panty by the Front Door for an Un-invited Perverted Stranger Who Followed Me Home

  2 years ago

  xHamsterjerkinginterracialcreampie

Categories

Other free porn sites